CAZyme Information: MGYG000004195_00540

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492
• CAZyme ID: MGYG000004195_00540
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		66213.65	9.8157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004195	1809545	MAG	United Kingdom	Europe

• Gene Location: Start: 85479; End: 87212 Strand: -

Full Sequence      

MKQKNLFKFIFYTITMILTFTYIIYRIFFTIPTTLGIISLISSILVLFIEIWESLDFFAY
YLNILCVKKISPKIPDLSNITQYPDIDVLIATINEHETLLKNTVTACKNMNYPDKSKIHI
YICDDGNRANIKKLAENLGVNYLSRITNKNAKAGNYNHALNHISSPFVATFDADMAPTPN
FLLTTLPFFYDNTTKFSEKIKRKKSKKLSAKNNIENIENIENMENTGNMKNMENTGNMEE
IGFVQLPQSFNNPDIFQLRFKLENKIPFEQEYFYHSIQIAKNATNSAIYCGTNTLFSRKA
LDSCNGFATGTISEDIATGMLIESNGYKCLALNNVEAYGTAVNDLSGFVKQRSRWARGCV
QILKKYKILKNKGLSFSQKIEYLSCISYWFFGVRRMVYLLTPLLFSIFGVIIVDCNLATF
ISIWLPTYILKRFTLDIFEGNKRSSTWNKIYETILTPVLCKEVLKEFFGFGNTKFEVTPK
FSKTTKMTKTNKKLLASHLILLILNIIGLVMCLFRIKTTGITVYVLSLLWLISNIFYLTI
SVIFDSRTKCSPFPDFVPNKIGVYKKFSVLGIFFGRK

Enzyme Prediction     

No EC number prediction in MGYG000004195_00540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	87	302	9e-23	0.9764705882352941
GT2	240	411	5.8e-16	0.751269035532995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	5.80e-87	84	363	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
TIGR03030	CelA	1.07e-84	15	479	64	497	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	1.20e-59	79	478	255	607	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.34e-39	31	479	2	377	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	5.19e-19	94	366	8	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY80065.1	1.13e-139	15	544	15	496
AAK79528.1	1.77e-135	15	544	17	496
AWV81228.1	1.77e-135	15	544	17	496
ADZ20613.1	1.77e-135	15	544	17	496
AEI33806.1	1.77e-135	15	544	17	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.36e-55	38	538	228	682	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	9.00e-48	8	480	54	496	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.60e-47	8	480	66	508	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.61e-47	8	480	67	509	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37653	6.73e-55	38	538	228	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	9.18e-55	38	538	228	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q93IN2	1.12e-53	38	535	228	679	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	1.53e-53	38	535	228	679	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P58931	1.98e-52	82	549	157	579	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
33	55
374	393
403	425
494	516
521	543