CAZyme Information: MGYG000004195_01110

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492
• CAZyme ID: MGYG000004195_01110
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000004195_11|CGC1	26858.96	5.4568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004195	1809545	MAG	United Kingdom	Europe

• Gene Location: Start: 63462; End: 64163 Strand: +

Full Sequence      

MKIFKKIIFIVVLVSISIGLLFVGNGYDMYKQAIEQISVEDKIAEIKSKENYTNFSELPQ
MYKNAVIAVEDHRFYKHNGIDIIAICRAAFNDIKAMSFVEGGSTITQQLAKNIYFTQEKK
IERKIAEVFMAFEIEKNCDKDEILELYLNTSYFGDGYYTPKEACRGYFNKELNEMTDYEC
ILLAGIPNAPSVYAPTKNPDLAKQRQRQVIDKMVKYKCLTQDEANEILLQNNN

Enzyme Prediction     

No EC number prediction in MGYG000004195_01110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	43	214	1.7e-62	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.99e-78	52	214	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.75e-76	52	226	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.07e-69	1	226	9	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.45e-65	43	226	59	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	3.11e-44	3	230	8	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM09777.1	3.42e-89	6	230	19	243
QRP41835.1	6.30e-88	25	228	28	231
ASN93505.1	6.30e-88	25	228	28	231
QJU22158.1	6.30e-88	25	228	28	231
ANU46909.1	3.62e-87	25	228	28	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.97e-43	49	226	19	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.84e-43	49	226	19	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.12e-34	41	232	48	245	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.21e-34	41	232	12	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.24e-34	41	232	13	210	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	4.62e-43	33	230	30	226	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q5FAC7	8.83e-43	47	228	65	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
O05131	8.83e-43	47	228	65	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
P0A0Z5	8.83e-43	47	228	65	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	8.83e-43	47	228	65	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.948759	0.041918	0.008241	0.000118	0.000075	0.000921

TMHMM  Annotations     

start	end
7	24