CAZyme Information: MGYG000004197_00204

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A
• CAZyme ID: MGYG000004197_00204
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MGYG000004197_3|CGC1	70968.04	5.489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004197	2419423	MAG	United Kingdom	Europe

• Gene Location: Start: 30622; End: 32520 Strand: +

Full Sequence      

MKKRLTLFAVGLSLIGIVGQAAPKTKSAAIRKTPPAVQTHLDGHIGNRIDACIRVRVMSE
DENLLVAPFKTQNESTLWQSEFWGKWMLGAIDAYRYNGDPELLQKITNAVNGILATQLED
GYIGNYKPEAQLDYWDVWGQKYTLLGLQSYFDLTGDKKALEGACRLADRLMTQIPAKKEI
EAAGFYQGLPAISILEPFVYLYQHTQNEKYLDFARYIVSRMEAPEGPKLISKALDGVPVA
ERSRTSGNINDWYNRVNGQKAYEMMSCYNGLLELYKITKNPEYLDAIEKSIQNIIDEEIN
ITGSGTAFECFYHGKRRQTEPTYHTMETCVTMTWMQVCKNMLDLTKNPMFADQIERTMYN
ALFASLKEDAAQIAKYSPLEGARSAGERQCGMHVNCCNSNGPRAFAMIPDIAVTTSQDSI
YVNLYGPMSSTVQLGKREVTLEQTTTYPEEGNIEISVDVPKNAEFALSLRIPSWSKVSQV
AVNGKAIGDIQPGSYVTIKQLWQSGDKVTVNLDMRGRLTELNGFQAIERGPIVLARDSRF
NDGFVDETSIIQADAEGYVTLMPIAEEDRPEKMWMAFTAPMVMGTDLEGDLAKPLQIKLC
DFSSAGNTWNRSIRYRVWLKKTLDVRGLKPNE

Enzyme Prediction     

No EC number prediction in MGYG000004197_00204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	72	534	4.9e-65	0.9103053435114504

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.13e-76	41	535	5	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.17e-58	23	550	1	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	3.93e-06	94	300	559	748	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG1331	YyaL	1.63e-04	82	195	411	521	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG4225	YesR	6.93e-04	133	226	32	120	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.02e-201	41	625	29	612
SCM56172.1	2.42e-41	99	544	113	562
BBD44699.1	5.34e-41	97	548	8	463
BBD46518.1	2.15e-40	97	548	114	569
QHS51661.1	4.81e-40	85	537	123	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.73e-34	146	541	151	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	4.14e-31	62	533	56	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.69e-29	62	533	56	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.55e-24	79	538	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	2.22e-23	63	607	56	646	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.22e-22	63	607	56	646	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000901	0.998011	0.000457	0.000235	0.000200	0.000185

TMHMM  Annotations     

start	end
5	22