CAZyme Information: MGYG000004197_01464

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A
• CAZyme ID: MGYG000004197_01464
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43603.76	9.0318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004197	2419423	MAG	United Kingdom	Europe

• Gene Location: Start: 13485; End: 14624 Strand: +

Full Sequence      

MRYYLIAGEASGDLHGSNLMKGILEADPQAEFRFWGGDKMAAVGGVENLAMHYKKASFMG
FVEIARNARTILKQIDMCKKDVADYRPDVLILIDYAGFNLRMARFAKESGIPTYYYIAPK
VWAWKEGRVKKIRRYVDRLFVIFPFEPDYFRKHGVEAIYMGNPLMDSIEERKASLPTREV
FVREHALDERPIIALLAGSRRSEIKYNLPFMVDLSREFPQYQFVVAGVSWLDREVYKPYL
EGSDVRYVCDRTYELLSISEAAVVTSGTATLETALLGVPEMVCYRRDLPTMLIGKMFLKI
PYVSLVNLVLRRECVRELLQFQMNMPNATQELSDILPGGKKHDRMLADYAELRRLIGDAG
ASHRFGKRMVELLREEKGR

Enzyme Prediction     

No EC number prediction in MGYG000004197_01464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	8.2e-112	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.24e-110	1	378	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.53e-103	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.88e-82	4	341	2	344	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.17e-70	5	372	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.83e-52	57	327	49	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24435.1	1.87e-226	1	377	1	377
BCG53033.1	1.27e-206	1	376	1	376
BBL11605.1	2.22e-169	1	374	1	374
BBL08813.1	2.22e-169	1	374	1	374
BBL00808.1	1.28e-168	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.51e-40	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.51e-40	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.68e-74	2	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	6.11e-68	5	375	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.25e-67	2	377	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.04e-65	2	375	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q3A550	5.22e-65	2	379	9	388	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004197_01464.