CAZyme Information: MGYG000004199_01290

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-449; CAG-449
• CAZyme ID: MGYG000004199_01290
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		34547.78	5.4794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004199	1652569	MAG	United Kingdom	Europe

• Gene Location: Start: 1503; End: 2384 Strand: +

Full Sequence      

MKRTGIITTSNARINRLINNILWGQKSNFVDIPTDCPQRDERLGWTGDINAFCNAATYNY
DIRLFMKKWLNDVRNDQKETGEIPHVVPDCLNDSKHTNAMWCECIVMIPWNMYWTYGDKS
FLEDNYLAMKKFISAREKTMKNGLIYKGNEFGDWLALDQEVMSTETIKGRTDPYYITNIF
QVNDLKILMEIAKVLNKEEDEILYRQKYETMLTKVREEYFTLSGKLCYDTITAQVLALYF
DIVPSQFKEKLAKELNDNMIKHCYEVVTGFICTTFCYLHLQIMDTLRPREECF

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	1	277	6.5e-73	0.5277777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.65e-81	2	286	1	276	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYH55287.1	6.43e-74	1	275	407	681
QPH41081.1	5.65e-72	1	275	447	720
QKJ29338.1	4.19e-69	1	275	327	598
AYB29519.1	7.40e-69	1	275	448	721
ASU32381.1	1.04e-68	1	275	445	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.13e-49	1	270	426	696	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	6.40e-40	1	277	462	768	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.50e-36	9	273	604	854	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.75e-50	5	273	474	738	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.33e-43	9	273	474	738	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.91e-35	9	273	604	854	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	4.04e-22	1	261	486	755	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004199_01290.