CAZyme Information: MGYG000004200_01600

Basic Information

• Species: F23-B02 sp000431075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp000431075
• CAZyme ID: MGYG000004200_01600
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	MGYG000004200_24|CGC1	66653.56	7.5377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004200	1810687	MAG	United Kingdom	Europe

• Gene Location: Start: 9141; End: 10907 Strand: -

Full Sequence      

MNGITLVFPIVTALFILLFFFGCPAPKTAELGSDARRSFSQRDALVLGLIVIIYSSVAFY
NLGDTKAPQSFYRFEPSESVELDLGREQTVSSLMLYTGLNTGSYTVEYSHDGEYWYTAAT
VEQNYAALFKWVSAQFIDGTDANTRYIRLTADSELYLGECAVKGENGSLIECKTNASELF
DEQSVVPDYQYYLNSTYFDEIYHARTAYEHLQGINPYEISHPPLGKLIIAFGIKLFGMTP
FGWRFSGTLFGVGMLPVLYVLLKKMFGGIAVPACGTAIFAFDFMHFTQTRIATIDTYAVF
FILLMYLFMYLYVNGGRLRHLALSGVFFGIGVACKWTCLYAGAGLAVIWLIHWISRLKDG
CGAKQFIKNCLFCLVFFVAIPCLVYYISYFAYGTASGMHGVGMFFTKEYADIVIENQKFM
FTYHSGVHSEHPYSSRWYQWVLDIRPILYYLLYFDNGTRSSFGAFLNPVLCWAGLVSVVM
CAYLAISRKDRISAFIVIGYLAQLLPWVFITRTTFEYHYFPSAVFLTLALCRIFSLMRTG
TRCWRANVYGLTALSIILFAVFYPVLSGQPVNSELATRLLKWMPSWPF

Enzyme Prediction     

No EC number prediction in MGYG000004200_01600.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	193	391	6e-53	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.82e-21	414	584	4	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam13231	PMT_2	1.14e-14	220	357	1	137	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	4.63e-14	414	588	502	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.96e-14	192	389	44	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	9.92e-14	191	385	16	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	2.72e-168	4	588	11	653
QQR07704.1	2.72e-168	4	588	11	653
QIA32159.1	8.71e-166	4	588	7	649
ALP95330.1	1.47e-155	36	588	62	752
QBB67038.1	2.93e-155	36	588	62	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	7.56e-23	198	586	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.56e-23	198	586	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.32e-22	198	586	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997171	0.002579	0.000212	0.000011	0.000006	0.000025

TMHMM  Annotations     

start	end
4	23
44	63
240	262
291	313
328	350
371	393
464	486
493	515
519	536
543	565