CAZyme Information: MGYG000004201_01378

Basic Information

• Species: CAG-110 sp900553805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900553805
• CAZyme ID: MGYG000004201_01378
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000004201_35|CGC1	92026.07	5.2342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004201	2436088	MAG	United Kingdom	Europe

• Gene Location: Start: 8497; End: 10923 Strand: +

Full Sequence      

MKKLTLNGAWVLDIPGSRFPRVSATVPGSVYHDLLTAGQIEDPFYRDNENEALKIMDNDF
IYSRDFTVPADLLESDAVLLHCDGLDTLATVTVNGVVVGTAKNMHRIYEFDVKSVLKAGE
NHISVKFDSPTRFIKKSYAESRADGSSDAMVGFPNLRKAHCMFGWDWGPRLPDAGIWRSI
QLIGITTARIRDVLVLQEHSGGKVTLRVTTHVTELTGSAPVTVTVTAPDGTVHTAQGERA
EIVIDDPQLWWPNGLGAQPLYTVEVTLGDGLDSWKRRIGLRTMTVTRKKDQWGECFCHCV
NGVDVFAMGADYIPEDNLLPRVNPDRTRRLLEDAKLANMNCIRVWGGGYYPDDYFYDICD
ELGLLVWQDFMFACAVYNLTDDFEENIRAEFLDNVRRLRHHPSLALLCGNNEMEEFVDVG
EWVDCPRQKADYIKMYEYIIPKILKAEAPQTFYWPASPSSGGSFDKPQDPTRGDVHYWDV
WHGLKPFTDYRNYLFRYVSEFGFQSFPCMETIQAFTLPEDRNVFSYVMEKHQRNASANGK
IVSYLSQMYLYPRDMELLVYASQLLQAQAMQYGVEHWRRNRDDKHCMGAVVWQLNDCWPV
ASWASIDYFGRWKALHYYEKRFFAPVLISCHEEGILSQNTNVNAEPFALKKSARLNVSNE
TLRPFTGKAHWALRRPDASIIESGSFDVSVAPLSTQWLPEQDFSDQDTYGCYYSYSLEDE
AGKPVGEGTVLFCAPKHFHFADPQLEVRQEGDEIVVTAKAYARSVEILAGPDTLLEDNYF
DLNAGTKRVRVLRGEVKELRARSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000004201_01378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	759	2.8e-117	0.7606382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.08e-93	1	671	10	690	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	6.66e-13	654	737	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	1.79e-11	188	281	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	3.07e-08	742	806	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	2.25e-07	174	289	168	284	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25065.1	0.0	1	808	1	810
QTE69834.1	0.0	1	808	1	811
QTE73768.1	0.0	1	808	1	811
AHF25196.1	0.0	1	808	1	823
AUS95659.1	0.0	1	808	1	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.60e-145	1	785	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.64e-145	1	785	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.17e-144	1	785	1	823	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.20e-144	1	785	3	825	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	4.43e-140	4	788	9	812	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	3.22e-118	24	690	30	728	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	6.63e-117	6	633	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	2.67e-116	26	633	32	663	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A2QYN2	3.64e-116	26	633	32	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
B8NW36	1.09e-113	26	633	32	663	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004201_01378.