CAZyme Information: MGYG000004201_01637

Basic Information

• Species: CAG-110 sp900553805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900553805
• CAZyme ID: MGYG000004201_01637
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43004.5	4.5858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004201	2436088	MAG	United Kingdom	Europe

• Gene Location: Start: 10831; End: 11991 Strand: -

Full Sequence      

MKQTRLIMLAAALVVIAALSLAAPHERIANAQPVCLSSTEEQEEHMSALEFAASMKIGWN
LGNTFDAPGGETAWGNPVTTKELLQLVKELGFETIRIPISWGKHVSAAPDYIIEADFLER
VDTVVSQALDDGLYVVINSHHDNELYMPTPENADSARQYLDAIWRQVATHFSDRDHKLVF
ETMNEPRVTGVSYEWNIDTQNPECMAAIEVVNQLNQTALDAIRRTGGRNADRFVIVSAYA
GSPNSTLIGAFHLPEDSVDDRLIVSLHAYTPYRFALDMKSGDAAFDRVNENEIRSLIRNV
SYRYVQKGIPVIFDEMGCLDKNNPDDRYAWCVAFVSAARENGIPCLWWDNGCISGSGEKF
GMIDRKGLCVYEQSQSAYQGLIDGMK

Enzyme Prediction     

No EC number prediction in MGYG000004201_01637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	351	4e-89	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.43e-68	71	351	16	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.49e-37	49	355	45	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF25951.1	4.16e-104	48	372	47	381
ABX42426.1	2.42e-97	39	370	105	455
QUA54155.1	8.24e-97	7	368	9	386
AHF24954.1	2.04e-96	48	365	119	451
QPZ86389.1	6.13e-96	48	365	51	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4X0V_A	7.21e-94	47	377	39	390	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
5H4R_A	2.04e-93	47	377	39	390	thecomplex of Glycoside Hydrolase 5 Lichenase from Caldicellulosiruptor sp. F32 E188Q mutant and cellotetraose [Caldicellulosiruptor sp. F32]
6WQP_A	7.25e-89	42	365	10	338	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6PZ7_A	3.26e-85	46	368	7	322	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
3NDY_A	2.00e-83	48	368	12	326	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23660	5.41e-88	46	365	25	345	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P17901	6.49e-81	49	385	48	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28623	6.62e-81	48	368	43	357	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	4.79e-78	34	380	28	373	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
Q12647	8.25e-78	44	385	21	359	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.998943	0.000209	0.000202	0.000165	0.000157

TMHMM  Annotations     

start	end
7	24