CAZyme Information: MGYG000004203_01392

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000004203_01392
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1642	MGYG000004203_10|CGC1	177465.8	4.2844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004203	2860639	MAG	United Kingdom	Europe

• Gene Location: Start: 87684; End: 92612 Strand: -

Full Sequence      

MKKRRNFHKRMLAFLLSLALVITTAYVPELMVQAAPGTTQLITGTWTSDAGAGSGVLDTS
ASGEGVITMNSVSSGDTWYAPQIISNDFAVKAGNEYAVSFKYKLEGTSNNTLEYIIQENG
GSYKVFDTEGSNATTNTRTLTYDAASADSEGYCSYSRTFTADESRSAVHLVFGMGNSEAN
GATVSLKDIFVTTDADDSGSTPVIGSNFIDFNLIEQSDFIDGGTDAVVEYQGTKAIVTAT
DWGNEWGADSKWQIQLKNLVTVNPNEVYDFSFKVKSDVARSIFVKLGDLDNDDTVFYQDT
VSLEAGVEKVVSGTTSGAVTIEKLMLVLALGDQFNGANTIEISEFTLTGQTSGEVEVTPY
IEFDKIDHSDFTDGVDAQIAYQGTTATITGTDWGNEWGADSKWQIQLKNLVPVTANDTYD
FSFTVKSEVARNIFVKLGDVDNGDTVYYQDTVALEAGVEKVISGTTTADVAIDTLMVLVA
LGDQSNTTNTITISKMWLKGHNTGWVKAGSTGGNVGVKGKEYDFAATEDNAANDYADPGT
AKEGYKLIWADEFDGNYGTANVDAATGLNLDNWAYQLGDGTTDCSNPGWGNKELQAYTGN
PENIAVNEDLSGNGTGDGLLRITASYEDAGYVYGSESSKKYTSARIRTTKADGALFNTTY
GYIEARMSLPGTQGAWPAFWMLPQSTSIYGGWPVSGELDIMETCGAFANGSNAQTCSTLH
FGAPDHVYEGSGYVTLNSDYTYFHTYAVDWQPGQITWYYDGKAIYTMNDWTSGYSGASDT
LSFDAPFDQPFYILLNLAVDSGQFGGATNKATFQDDINMYVDYVRVYQKEAGYADYAQRS
TGMDTTDDWSNYAGINQIAPIKADNIVTDVAGGDVNGLESNGTVDASKWYLGYQSDASDA
TAESYTDGDGNVWAKVGVNSKGSQDYSVQLIGHYNAKTGYVYKVSFEAYADGGMVGKTVN
CDSKEWRGWSTFGIQSFELKDTPTKVSYLISQKKDFENCRIEFNLGARGTGNVYLGNVKV
EIVDPATLGAESENRNALGNGNLIYNGTFDQGNKHIGYWTAAQETKLEVPRYTTTKLADS
DVSVVDVASKTNYEGIANGVKYYERRAQISTEAGKAPIIYQSGMKMIADHYDLGLDVYSA
ADTDVIAAIYSTNEAGVPDKLVKAATISYKATSGVKHLAWSIDLDETIENAALVLKFSNG
ASVQVDNVTLIGSSQGEKVDKTPVTTDSDWNADDGDGGALALEKNAGVYTLRNIVSGANW
YCPQIKSKQFSLVNGKQYKLSMKYKLEGTSNNTAQYIVQEQNGTWHVFAGGPTTITYDAA
KADADGFCSYELTFTADTSLSTVAIGFGLGGSEANGAADFSFKDVTLTYVESGSESGGEG
ADVWNPVTEDIMKDNSGQNPDKPNTSGGQAAAAPEIKADWNHVKDMVENAKKAQPKENVT
INEVVGNDMIISEELYGMLKGENIVLALSNGDGVTISVEGNKLKGRNREIDLSLAKTNTK
IPAAVLAEKAKDAYRNKLVIFNGSETLPDGLNMHFRFGAENAGRYANLYRYDETTGRLIY
QWSFKITDEGAAMFALRRTAPYFITVTDSMPVGENGVYTVVPGDTLSGIARRNGVRLAQL
LSWNPQITNPNRIRVGQKIYIR

Enzyme Prediction     

No EC number prediction in MGYG000004203_01392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	549	827	2e-65	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.74e-69	549	827	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	2.56e-46	544	828	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	5.68e-38	547	828	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	9.10e-30	551	827	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	7.60e-20	586	850	62	285	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35059.1	0.0	374	1378	202	1195
CBK74620.1	0.0	482	1315	3	828
QTC43864.1	1.69e-74	539	1214	230	853
QWC21218.1	2.54e-74	539	1214	115	738
CCG46551.1	1.89e-70	537	1225	220	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ATG_A	2.40e-36	547	845	5	256	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	9.67e-35	547	828	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
5WUT_A	1.17e-33	543	828	3	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6JH5_A	2.31e-32	543	829	2	233	Structureof Marine bacterial laminarinase [Aquimarina]
4CRQ_A	4.44e-32	545	829	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	3.88e-38	504	830	373	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	4.06e-32	547	806	22	243	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
P45798	9.15e-29	545	828	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q9ZG90	2.47e-19	545	828	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
Q9Z3Q2	4.73e-17	576	831	230	461	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998931	0.000182	0.000201	0.000168	0.000148

TMHMM  Annotations     

start	end
12	34