CAZyme Information: MGYG000004203_01899

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000004203_01899
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33563.09	3.8699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004203	2860639	MAG	United Kingdom	Europe

• Gene Location: Start: 42850; End: 43761 Strand: -

Full Sequence      

MRRKLVLCLLCMMFIMNGCQQNGDNFVEYDSDEITEADNIAEAVDATETGTPTETDVVTA
TGDISEDTLRKEVFALVSSAENSSTDYAEQYQYIEDIGDGRGYTAGIIGFTSGTGDLLDV
VNRYTELKPENELEKYISALQKVNGTDSHGGLGDAFVADWKTAAQSDEMIQAQNDILNAQ
YMCPAIAYAKEDGLSPLGQYIYYDALVVHGSGDSIDCFEAIRDAALTKAAAPSDGGSEYD
YLTAFLDARIPVMQMEDAHSDLSRIDTQRKFLEESNYNLELPLEWNMYGDFFILDDNRIK
TLR

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	72	279	9.4e-68	0.954954954954955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01374	Glyco_hydro_46	1.06e-107	76	283	2	210	Glycosyl hydrolase family 46. This family are chitosanase enzymes.
cd00978	chitosanase_GH46	2.99e-94	67	283	1	222	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ71338.1	2.65e-93	62	294	33	268
ANZ69519.1	2.65e-93	62	294	33	268
AEV96035.1	2.65e-93	62	294	33	268
QXE01475.1	3.51e-93	59	299	37	278
SEU06030.1	6.82e-93	60	295	38	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ILY_A	7.29e-82	66	292	19	247	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
1CHK_A	3.98e-81	66	295	6	237	StreptomycesN174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4OLT_A	7.81e-81	61	295	13	248	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	1.27e-79	61	295	13	248	co-crystalstructure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]
7C6C_A	6.31e-35	76	293	14	241	ChainA, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33665	1.98e-80	66	295	46	277	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
P48846	2.25e-79	66	295	47	277	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1
O07921	8.06e-34	76	293	49	276	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000088	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004203_01899.