CAZyme Information: MGYG000004205_00189

Basic Information

• Species: RC9 sp900546445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546445
• CAZyme ID: MGYG000004205_00189
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000004205_1|CGC3	43373.61	5.2528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004205	1871322	MAG	United Kingdom	Europe

• Gene Location: Start: 206149; End: 207315 Strand: +

Full Sequence      

MKRLFLALAGSALFLLGAAAQEAIWPGSELVSPEVNDATGQVTLRLYAPDASKVEVVGFC
TDGYEPMTRDSSGLWTWSKTLPSELYYYNFVVDGVKTLDLANSYVYRDVSYLSSYFIVGG
GKGDDYKSREVPHGNLSKVWYHSDKTGTDRRMTVYTPAGYENGKGRYPVLYLLHGRGGDE
DAWTSLGRAQYILDNLIAQGRAKPMIVVMPNGNTDRHSAAPGEDGQGMYKPYPCGATDTS
FEEHFGDVISYVDSHYRTIRKKSGRAIAGLSMGGFHSNIISVNYPNTFDYVGLFSAAPTT
WRIQTDESLYSAPNFYENYDAKLKALFDNKIALYYIAIGDTDFLYEANCEFLKKLDEIGA
DYVYVESKGGHIWANWRDYLTDFIGRIF

Enzyme Prediction     

No EC number prediction in MGYG000004205_00189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	143	384	1.4e-57	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	7.04e-31	66	388	6	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.96e-25	40	119	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	2.25e-20	143	387	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.12e-18	153	387	38	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd02858	E_set_Esterase_N	2.86e-11	40	112	1	75	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXN65677.1	3.19e-124	16	388	15	395
ALJ59664.1	3.96e-124	20	388	19	392
AHW58566.1	2.67e-123	20	388	21	397
ASV29453.1	3.06e-122	21	388	22	397
BBD44687.1	2.35e-121	29	388	31	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	8.02e-94	28	388	20	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.21e-55	41	388	47	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	4.27e-46	41	388	26	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	7.03e-46	41	388	47	379	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	6.83e-42	33	388	17	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.05e-46	26	388	324	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	4.66e-44	37	388	44	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	1.34e-30	26	295	390	653	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	1.10e-27	123	384	38	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	2.36e-10	108	288	145	311	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000372	0.998941	0.000197	0.000171	0.000154	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004205_00189.