CAZyme Information: MGYG000004208_02066

Basic Information

• Species: CAG-485 sp900759795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900759795
• CAZyme ID: MGYG000004208_02066
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		48386.88	5.0196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004208	2882561	MAG	United Kingdom	Europe

• Gene Location: Start: 6637; End: 7926 Strand: -

Full Sequence      

MKIKALLTAVWLCVAALPAMSAQRYVGGDISLLPEYEKAGAQYKAPSGEPIADLIPWLHR
QGMNAMRVRLFVNPAKYKELHQNDANADTRYDPNACQDLEYIKPLCKRIVDSGMDLMLDF
HYSDTWADPAKQWTPIDWEGLTDEQLYQKIYDYTRDVLTQLKDYGVVPAFIQPGNEISYG
MLWGSAGTSSPKKALMGSDANWERFGKLLRQAVKACQEVCPDAKIILHTERVAQVDVLKN
FYDKMKELDVPYDIIGLSYYPYFHGGLNVLDKALQSMQNNFLSKNVMIVETGYSYKWELP
GTNHDNTQTWPYSEAGQAKFVTDLVTDLEKYDQVDGLFWWWLEYNAYGTSLSGWYNAPLF
DSTTGRATAALSALCSYATSGIVTLHPDDLDPSGLSDSDSWYTIAGRCLSAAPTTPGLYI
RNHRKVMVQ

Enzyme Prediction     

No EC number prediction in MGYG000004208_02066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	372	2.4e-86	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	7.97e-80	25	374	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.22e-67	27	383	42	400	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	2.28e-137	15	426	10	413
VEH14955.1	5.24e-129	18	378	41	398
QVJ80245.1	4.22e-113	15	426	10	420
QUT66820.1	2.21e-90	1	374	1	360
AGB28452.1	1.50e-86	12	396	11	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.20e-43	18	371	44	388	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	1.85e-36	22	372	1	327	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	2.03e-36	25	350	21	326	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1R8L_A	1.22e-33	27	340	27	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
1HJQ_A	6.54e-33	22	372	1	327	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.96e-51	26	325	8	291	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q8X168	7.75e-38	12	350	5	326	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
A2RB93	1.08e-37	12	350	5	326	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
Q9Y7F8	5.58e-37	12	350	5	326	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
A1D3T4	1.69e-36	19	372	19	351	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998799	0.000257	0.000175	0.000173	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004208_02066.