CAZyme Information: MGYG000004209_00274

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004209_00274
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	MGYG000004209_2|CGC2	24825.9	4.6775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004209	2134494	MAG	United Kingdom	Europe

• Gene Location: Start: 85245; End: 85907 Strand: +

Full Sequence      

MPDYEIVRWDESNLDLDFCDYAREAYKAKKWAFASDYARFKILYEQGGIYLDTDVEVIRS
LDPILEQGPYMGFEVDCSEENKGTVASGLGLAANPGLGLAANPGLGLYKDILDSYEHDHF
LKDDGSYDLTTVVERVTGILRERGLRDVPGIQEVAGVRIYPSEYFCPKDPINSCLTLTEN
SYSIHHYDGSWTTGKQKFHKRISYLIGPKATDVIKNLFGR

Enzyme Prediction     

No EC number prediction in MGYG000004209_00274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	2	67	3.4e-18	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	8.18e-14	1	67	15	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	3.82e-12	2	69	111	182	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	0.001	1	115	76	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.006	21	54	160	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD73870.1	4.06e-68	2	217	32	244
BAQ56421.1	1.16e-67	2	217	32	244
AEE17470.1	2.59e-64	1	197	31	213
QWT54350.1	4.50e-64	2	202	41	234
QIA43512.1	1.16e-60	2	214	36	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	7.77e-06	2	65	86	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004209_00274.