CAZyme Information: MGYG000004210_02066

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004
• CAZyme ID: MGYG000004210_02066
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1293		143785.76	5.017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004210	2253787	MAG	United Kingdom	Europe

• Gene Location: Start: 6087; End: 9968 Strand: +

Full Sequence      

MKRKALAVVLILAMLLSMGSYSMSDSTAMAKDVPESSGFTKMDMNKTLGNPGGFLLSDGQ
TAARVYVDTAREEFSESGGKGYCGLEIIAETFAKDVGLVTGKDADVITSAKDMQGSVIIA
GTIGGNEVIDALIARGAIDVSGLYKDGGLKWDCYQMQFVGEDVLSACGYNGVENALVITG
SNKRGAMYGLFNISEHIGVSAWVYMADAVPVQYSSVWLDSSLLEFNQADKYLAKEPSVKY
RGFFINDESPSFTGWAGGAFGGLNENCYEHIFELIIRMKANYLWPAMWGNSFSDEGKEFT
LANAVLADAYGVCMGTSHHEACHRAGVEWQRKYKSYGTSNAWDYDKNGEAIYKFWEEGIE
RNGNFENTITMGMRGEGDSALKGGVQYNIDLLKRIISDQNNIVDNYVADNPDAKTKDALK
IYIPYSENEEYFYGPDDGSIEGLNVWEGLDDVTIMLTDDNYGNVRSLPEESVRYREAGWG
LYYHLDGHVGSGAYEWVSSTQLEHIWDQLTMAYDYNVRNIWVVNVGDVKPLEMEINYAMD
IAYDMEKWGQPNTAEAYRKEWLQKQLGGKEGCPDNVAAEAAECVADFLKISTYRKAEYVN
PTLYSNVNYNEAQEVLNLCNETINKVDYLYNTYFKNTAWDDAFYQIVYYQAAATANVTRM
MIFKSMNDFYAAQNSSLANIYAAYVDECVEWDKELTDYYNNQMSGGKWKKMMSSPHVGFV
TWNSDGWSYPKGSVITLPSEAKMLVSFDGDEKAYDSGTAGLPLFTNTVKQRYCVTMSNGG
TDEYSFTAGTLADWIQITDKEGKQIVNGGTVKDAAYFYISVDWSRVRSEKTGTVVIKGNG
QTVKLIVNTSYTEYKSKGIGTHFESNDAVVIDADEYVDNKASAEGVKWGLIDGYGRYNCA
MKMFPTTVSFTKPTGATHDVKVGNNIRTVTEYEDNFDAPYIEYRFYVDEDDDYTFTAYTT
TTNNIFKPSGWGYVPVELFYGVCVDDQWMTQVNSLPDGKYISYAADGDNRWKDGIMNNIH
ISESTEYMTAGIHTVRIYGMHAGLGLERLVISNRDIKESYLGPQKTFMLDYDIIPEQKNG
VHYEAAAGTLSYGKPADLSAITDPSDRNDAADSYELETPIPRPAQPVVDTELQGNKTQPD
GNGTNQNILQPTPSVDAIIKGNVYRYKGYRYKVTALKGSQGTVSIVSPVKKTIKKAVIPS
KIKLRGYTLKVTGIEKNAFKNCKKLKSITIGGNVKKIGQRAFKGCANLKKIKIKSEKLRV
VGKNAFSGISKNAAVTAPKKLVKKYKKLLSVKK

Enzyme Prediction     

No EC number prediction in MGYG000004210_02066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	84	726	4.5e-183	0.806312769010043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.25e-136	234	569	1	311	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	6.07e-28	861	1063	1	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam13306	LRR_5	4.06e-14	1193	1271	13	80	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.
sd00036	LRR_3	4.11e-14	1210	1278	47	114	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	1.22e-13	1210	1270	24	83	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ35136.1	3.92e-271	62	1067	14	945
AIQ23284.1	7.82e-271	62	1067	14	945
AGF58615.1	1.53e-269	62	1066	12	942
AQR97306.1	4.30e-269	62	1066	12	942
AEY65938.1	4.60e-269	54	1067	7	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	2.40e-173	84	1067	31	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	3.34e-146	52	1063	12	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.10e-101	65	725	55	653	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.48e-99	50	725	13	638	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.90e-97	50	725	12	637	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000418	0.997523	0.001407	0.000231	0.000217	0.000173

TMHMM  Annotations     

start	end
5	24