CAZyme Information: MGYG000004213_00899

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004213_00899
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
995	MGYG000004213_14|CGC2	108416.12	8.788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004213	2847158	MAG	United Kingdom	Europe

• Gene Location: Start: 21105; End: 24092 Strand: +

Full Sequence      

MKKLKCLAAVFAAFTFTAMTASAVTPVIIKKTDTKACERWVDSVYRSMSDRERVAQLVFP
KVVPTHGANSRAVIKRLVSTNGVGGLLFTEGTIDQYAEMTDYAMSFARSGKGVAPLMTFD
GEWGLSMRVKDTPRFPQNMGLGAIANTDLIYRYGAEMARECKLLGIQVNFAPVLDVNSNP
SNPVIGYRSFGEDPVKVGRLGKLYSRGLEDHGVQAVGKHFPGHGDTGTDSHKTLPTVNHD
LVRLNSIDLKPFSDFIDAGCSGIMTGHIALPVLDPSGTPASLSKKISTELLRDKMGFEGL
IYTDALGMKGATVEGRNNALMALEAGADVLLSPLNPVDDIDFIAGALKSGKLSRKTLEDR
CRRVLTYKYALGLSKPVSINTKGLAEAINSPEAEKLNRELAAASMTVIYNNDNILPLGKL
DKTSIAVVNIGAPADNVFASTCARYARVDRFYTNGASFSPETLAKIKSHDVVIAAVYNDK
SWARSTMAALKDCDNLVAVFMVNPYKMNKFAGSIKKAKALVLAYDDTPYTREYAAQAIFG
GIDVDGTLPVNLKGLAPMGTGVRLKKSRLGFSTPLAMGMKPSLTDSIDSIVAAALKVNAF
PGCQVLVARHGNIIHDKCYGLTTAGGAPVTQATVYDLASVSKATGTLPGVMKAYDLGLFS
LDDFASKHIPGLRVIGKDSITVSQLLYHESGIRPALNMFEVMTDSTSYTGDLIKGRPDAM
HKRKVQNGAYVHNTARIRRDITSATRSDRFPITAAEGLYVGRETYDTIMGRIYNSPLRAK
RDYAYSCLNFCLLMDMEQRLTSQPHDRFVTDSIFAPLGAYTTCYRPTLHHKLADIASTEV
DNYLRNQHLRGYVHDELANFSGGVQGNAGLFSNADDLAKICQMWLNGGVYGDRRVLSEET
VRLFTTSKSPTCRRGLGFDKPDTENLENSPTCDEADASVYGHLGFTGTVFWVDPANDMIF
VFLTNRVDPTRDNAAFSKVNIRPELFRQLYKALDK

Enzyme Prediction     

No EC number prediction in MGYG000004213_00899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	331	1.3e-60	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.02e-83	51	366	3	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	3.75e-78	48	436	1	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.14e-41	157	362	106	321	beta-hexosaminidase; Provisional
PRK03642	PRK03642	1.02e-40	600	969	55	403	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.46e-33	587	975	1	317	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35538.1	0.0	17	993	18	989
ASB36988.1	0.0	21	993	21	990
ANU62524.1	0.0	21	993	21	990
QQR10146.1	0.0	21	993	21	990
AHF12964.1	1.39e-305	15	993	13	987

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	5.26e-63	46	552	9	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.68e-62	30	568	22	640	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	2.45e-61	30	568	26	644	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	1.60e-60	36	568	2	614	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
3SQL_A	2.51e-53	82	376	57	354	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	2.56e-61	30	568	22	640	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.01e-49	74	417	55	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	6.48e-42	40	551	18	554	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P77619	3.38e-38	572	966	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
Q8XBJ0	6.17e-38	572	966	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000213	0.999189	0.000163	0.000151	0.000142	0.000133

TMHMM  Annotations     

start	end
7	29