CAZyme Information: MGYG000004215_01390

Basic Information

• Species: HGM13618 sp900753975
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; UBA1234; HGM13618; HGM13618 sp900753975
• CAZyme ID: MGYG000004215_01390
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000004215_30|CGC1	47612.95	9.1032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004215	1526818	MAG	United Kingdom	Europe

• Gene Location: Start: 2802; End: 4043 Strand: -

Full Sequence      

MKTLEFFENVQNILSFFLMFYSVYNIVIWLFVYAKPIKKKKIIKKKHKIMAVISARNEEA
VIGNLIESLNNQVYPKNKFDIYVIADNCTDSTAKVARNAGAIVYERFNEFKRSKGYALEW
FFDIVLKEFPDKYDAFCIFDADNIVAPNFISKMNEKLCEGETVVQGYRDIKNPGDNWVSG
NYAIFYWTMDRCYHSTRDKLGLSPLINGTGFMIAMSVLKEEGGWHTETLTEDTETSMNMI
AKGRRIAWANDAVIYDEQPTDFVEAWNQRLRWGVGTAQCLKACLPKMIKSKHMSPQLIDG
IIYLMGMPLILFSVLITGIDLLKFLLIPTKQGLALIQGKLFFVLAFAALSILHALWIVWL
EKKDVKKVWKGIVTYPIFLVVSYFVNFAAFFNMKLQWKQIKHESVVSIDDIVK

Enzyme Prediction     

No EC number prediction in MGYG000004215_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	275	9.3e-32	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.30e-76	52	224	2	172	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.15e-36	52	227	2	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.63e-30	13	408	21	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.03e-24	52	272	7	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	5.18e-14	52	271	34	243	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55360.1	2.20e-116	8	411	8	413
BCI60981.1	1.15e-106	10	411	11	413
CDZ24461.1	1.51e-89	5	411	5	409
QIB60565.1	2.83e-88	38	413	34	409
CBL06940.1	2.83e-88	38	413	34	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.04e-07	138	280	232	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.08e-07	138	280	244	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.08e-07	138	280	245	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	3.42e-06	48	269	43	259	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.43e-06	48	269	44	260	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8YMK0	1.50e-17	32	307	90	365	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P96587	2.12e-17	38	292	40	296	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	1.16e-16	49	307	108	365	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	1.70e-13	49	278	110	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q5HCN1	4.18e-08	17	292	6	287	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34
297	319
340	357
372	391