CAZyme Information: MGYG000004217_00731

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004217_00731
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		32740.83	4.6376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004217	1531184	MAG	United Kingdom	Europe

• Gene Location: Start: 65; End: 955 Strand: +

Full Sequence      

MQYRFDLAWCELMNYAHKKGIEVIGDIPMYVSDDSADAWSEPENFWLSDTGKAIEISGAP
PDNFAPEGQVWGNPTFRWDHMKKNGYSWWMDRLRRAFSLYDRVRLDHFLGFHSYFSIPAG
KACADGRWLAGPGKDLFQTAYDELGPLNFIAEDLGYLTPGVRAMASTCGFPGMDVLEFSD
YDVRCGIHPTPGKILYTSTHDTSTLAGWCTRSFAGGDKPSGTALAGELMGNALASDAPLV
MMPLQDILGLGDDARMNVPGVATGNWTWQAQEADIAAAEEKTAKLLRSTHRFWGEA

Enzyme Prediction     

No EC number prediction in MGYG000004217_00731.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	1	285	9.4e-88	0.6052631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	1.01e-110	1	278	192	482	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	6.90e-105	1	268	178	455	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	3.16e-82	2	291	219	525	disproportionating enzyme
COG1640	MalQ	4.51e-75	2	291	205	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14510	PRK14510	1.75e-63	1	269	926	1191	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33253.1	3.35e-209	1	296	803	1098
AZH69620.1	2.67e-208	1	296	803	1098
ATP53560.1	2.70e-205	1	296	803	1098
AEB07182.1	7.20e-137	1	291	803	1093
BCV18024.1	1.02e-104	2	291	878	1167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X1N_A	2.87e-67	2	294	217	522	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
2X1I_A	4.64e-67	2	286	189	491	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1TZ7_A	5.21e-67	1	286	201	498	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
7COV_A	8.65e-67	2	294	269	574	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
2OWC_A	1.35e-66	2	276	192	485	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q1	9.90e-75	2	291	191	494	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	9.90e-75	2	291	191	494	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	1.71e-68	9	269	200	476	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
O66937	9.07e-67	1	286	181	478	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
Q59266	1.34e-66	1	294	179	484	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004217_00731.