CAZyme Information: MGYG000004221_01504

Basic Information

• Species: UMGS621 sp900543915
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS621; UMGS621 sp900543915
• CAZyme ID: MGYG000004221_01504
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000004221_19|CGC1	22265.45	6.9339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004221	1971557	MAG	United Kingdom	Europe

• Gene Location: Start: 2258; End: 2842 Strand: -

Full Sequence      

MISKRKFSQIVFWTAVVCLAGLILIEGIPLARRIVYPVRYEETVRSLALRDNLDPALIFA
VIRTESNFRERAESGAGAKGLMQITDRTAEYIASSRGIEAYDLFCAEDNLDFGCWYLRYL
FDHFPDERTALAAYNAGEGTVRGWLSDAALSPDGKTLSEIPYRETEQYLEKISRTYEKYK
KYYPQLLDKTGKMR

Enzyme Prediction     

No EC number prediction in MGYG000004221_01504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	181	2.9e-29	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.85e-63	37	178	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.17e-43	36	181	2	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.52e-35	55	177	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.18e-29	6	192	108	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.30e-28	48	146	5	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41497.1	1.43e-40	3	183	6	188
QAT49510.1	2.70e-40	3	183	4	186
CAB1248982.1	2.30e-38	4	183	9	195
ADL52425.1	2.45e-38	3	183	4	182
QAA33953.1	3.12e-37	34	180	27	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.91e-20	32	172	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.92e-20	32	172	408	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.93e-20	32	172	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.94e-20	32	172	418	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.94e-20	32	172	424	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.26e-14	36	183	476	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.26e-14	36	183	476	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	3.68e-14	36	178	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.68e-14	36	178	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	5.79e-14	36	172	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.946660	0.043717	0.000731	0.000180	0.000108	0.008625

TMHMM  Annotations     

start	end
7	29