CAZyme Information: MGYG000004223_00351

Basic Information

• Species: UMGS1883 sp900763305
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900763305
• CAZyme ID: MGYG000004223_00351
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000004223_2|CGC3	81147.41	5.2811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004223	2575981	MAG	United Kingdom	Europe

• Gene Location: Start: 159355; End: 161550 Strand: -

Full Sequence      

MNYLTDKLINRAKWITAPEKFASPVIIRKFEAHHADNAILAVSALGFFTAYVNGSRVGDE
YFRPSDSLFCKRDTESFLYPIKDEFTYRCYYSVYDITPYLQDGENTLEIALGDGWFRQTE
RTAEGNLSFGSALGAIYAIHSENERFADVLSDGTEQCRSSEITESQLFYGETYDARIKEY
EYAAVRVIEMNETVLTKEIAPADREARRIKPVLISETDGRKIYDAGENISGFAVISAAPK
YGESVTVRYAEQLNGARLDFFSTGSDYKSPSGKAQIMEDTFIGDGQRHVFKPSFVWHAFR
YFEIEGEACAEYVSVLHSDVARAAHFHSSSEELNWLYGAFLRTQLNNMHGGVPSDCPHRE
RLGYTGDGQICSEAAMLMLNARDFYRKWIQDIFDSQDLKSGHVNHTAPFAGGGGGPGGWG
CAAVFVPYNYFKIYGDKSALTENYPRMKKWIEYLAAHSTGGLVISEEPGGWCLGDWCAPQ
KVVLPESYVNTCCFIKALRIMECAARISGAADDIRYYETLRGSAETSVFDNFYDKEKKTF
CCGVQGADAFAVYCGIAGSKVIASLLNKYEHAESFDTGFIGTMHLIGALFENGGENIAYK
LLTGHKPGTFGYMADRGATTLWETWDGALSQDHPMFGACSVYLITHILGITQEKNSTGFE
KVLIAPKIPEALAGAEGFAVTPRGKISVKWRKTGEKTVFVIELPENICGKFVCGDCEEKL
HGGDNTVTLKA

Enzyme Prediction     

No EC number prediction in MGYG000004223_00351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	216	708	2.6e-117	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.54e-69	321	647	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.53e-25	38	177	6	132	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.44e-08	218	306	5	86	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.46e-06	656	706	6	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	1.48e-186	10	730	4	725
BCJ98018.1	4.37e-148	14	706	127	851
QOY86540.1	2.30e-132	11	706	131	835
QUT50058.1	1.11e-115	42	715	181	860
QMW80401.1	2.49e-104	4	727	117	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.26e-60	42	730	196	917	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.78e-51	17	706	296	987	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.34e-59	1	717	138	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.47e-50	17	706	296	987	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.96e-49	11	706	150	871	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.26e-49	38	712	186	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999985	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004223_00351.