CAZyme Information: MGYG000004223_01596

Basic Information

• Species: UMGS1883 sp900763305
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900763305
• CAZyme ID: MGYG000004223_01596
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	MGYG000004223_13|CGC2	72078.88	5.1749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004223	2575981	MAG	United Kingdom	Europe

• Gene Location: Start: 47458; End: 49428 Strand: +

Full Sequence      

MKKIIAVLGTAAAIFAAQTVGAADVFVNSVPVGFNDSVGYPFIENGRMLVPLRASMEALG
AEVSWDGANNTAVVRKGTTTVACVIGENCVYRNGTKIVNDAAAVIRGSRTYLPIRVVAEA
LDAEVLWDGNVRITSGAAGNLIYSIENSGSHVSPAELWKLWDSALLQKASADYNAAIETI
KRIAPDFIAANDGNSNAMLYKHLGECYSELNLSAEASACFAREAQFWTQMGKTQETIDAN
RRSGLISSGVQMYAKTDRAEYAPQTKQGKFASARGIYLGAYAEGDPAVHNAATGNPFYMN
AFPDLAGRDMASYLLYLPDSKPLSTYQSHIEAAKKRNKILQIAVEPSSLSAITENDSRYV
KLAQDMEQSGAKFLVRLACEMNEESCPWYTTDYNLYIRKFRIMASIFHTYAPNSAAVVWS
PNFYPSDNISLYYPGDEYVDYVGISSYKNHQPETDPLGQNVDRSRWSDQLDTICGLYGYK
KPIIVSEGAASYMDYNTWGDITPFASSQLYDFLAYLPIKYPQVKAFYIYDHDRERYRFSL
SSNSEYLSAYRRGIASQSYLSEPNTDAGFEYYELGTNAAIPASVNEISAYIKTVKNDIAY
VVYRINGADCATAYAAPFSAAVDFSPYAGQSVNLTALAFDSSGAIAAQKTYRINVR

Enzyme Prediction     

No EC number prediction in MGYG000004223_01596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	342	490	6.3e-19	0.44554455445544555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	3.53e-28	44	132	1	89	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	6.10e-08	19	74	41	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG4124	ManB2	1.25e-06	271	513	77	336	Beta-mannanase [Carbohydrate transport and metabolism].
PRK14696	tynA	0.002	49	112	1	64	primary-amine oxidase.
pfam02156	Glyco_hydro_26	0.003	363	449	143	232	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSX05302.1	7.53e-179	19	655	26	665
AZN43604.1	6.99e-102	157	649	31	530
QNK58256.1	2.44e-96	152	656	31	538
QHT63759.1	1.38e-95	158	656	4	507
AMY96565.1	3.04e-94	199	656	1	461

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999103	0.000164	0.000168	0.000160	0.000146

TMHMM  Annotations     

start	end
5	27