CAZyme Information: MGYG000004223_01928

Basic Information

• Species: UMGS1883 sp900763305
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900763305
• CAZyme ID: MGYG000004223_01928
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681		76908.66	4.9304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004223	2575981	MAG	United Kingdom	Europe

• Gene Location: Start: 22914; End: 24959 Strand: +

Full Sequence      

MNFKKEEAAARLGYTKKQYIELIADNMIKTRPEKEVDYHPFLAQKGVKNMPVLYFDEISL
DEYYPDAQDGDFVFLRVGMTSGAEAEIVATVAGNAELFYGGQRILKTNQTKTPDPENYEC
VPVMLKKGINELVIKCTRCCGSFKLYFLTALKIFKVMKARDYLFHTRTVIAEGEYRGEEG
YEISRLYLKGESPEKIEYIYPPATKPGSDICFSVLNDNDRFGIAVTYALQDGKMMLRSSG
GINVFINGENACSGTAVETDIKKGDEIAVTCKKTDTFGFSYETDNAIGIPFLTSQRKNGI
DWLLLSTPEEITFSSSKIGFKKPYVFGDEKRFWRFADGSFLRIGLETSFFGQWFYALMVG
NYGLLNAAAAARRSDYRDYFAANMKTMIDYYDYALYDATLSGEASFLQRGTNPDNLDSIG
TMGMNFIEYYNLTKDESALHVIRLLENAMMTRIPRFSDGTFRRESTMWADDTFMSCPFIV
RLAKLTGNTEYYSELKRQIAGFKKRLYMEDKKIFSHIFFIDTGVMNRIPWGRGNGWVMLT
LTEILMNISSAHPDYSYYAEFFADFAEGALALQDEDGMWHQVLDIGDSYEETSATAMFVL
CFARGVKLGILDKDRFGAAAEKGMNALLEKRIDRNGNICGVCKGSGCSMEAKYYTELETA
YNDDHGTGIVLCALAAEADII

Enzyme Prediction     

No EC number prediction in MGYG000004223_01928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	348	675	8.8e-74	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.93e-55	352	675	26	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.08e-44	393	675	46	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19133.1	3.01e-127	22	675	25	733
APO43433.1	4.16e-75	11	673	14	723
QZN78692.1	4.12e-74	11	673	14	723
QOS82185.1	2.71e-73	11	673	14	756
QKS43911.1	4.43e-72	350	673	399	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.68e-34	364	673	91	406	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4CE7_A	3.84e-15	468	633	154	329	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3QWT_A	9.68e-11	468	657	167	357	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.90e-09	468	672	168	373	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.85e-22	407	675	64	333	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	2.13e-16	468	629	159	331	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	5.17e-16	468	673	201	404	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	2.23e-14	468	633	161	336	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	1.95e-09	474	633	1	172	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004223_01928.