CAZyme Information: MGYG000004224_00466

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390
• CAZyme ID: MGYG000004224_00466
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000004224_10|CGC3	44707.74	4.7068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004224	2221068	MAG	United Kingdom	Europe

• Gene Location: Start: 30207; End: 31394 Strand: -

Full Sequence      

MTLEIAEGAVILGVVDEKAYPPLPSRVAGIELTYWPAGLINAQNCENLTICGKGLVDGQG
EYWWYKFWGTPEENHQGGMIREYPDNLRWAVDYDCFRPQNFLLGNCKNLVIRDLHCERSG
FWNLHVYYSENVRIENVTIAKNLGPSTDGIDIDSCNNVVVCGCHISCHDDGIVLKSGRDA
DGLRVNRPCTNVEIYDCHLMAPSEGITLGSDMSGGISDVYIHDCTFDGARNGFRIKSART
RGGVIERIRVANLKMRDVRYAFSFQLNWFPEFSYCKIPEDYTGEIPEHWRILSQYVPPEK
GLPTLRDLTIENVTAVVDEEYEKMILSFLPPEQLQVTDTSRYIKELPLLFDIGTDPARPI
ENLTFRNMNLSSKTFGQIQSVRNLVLDQVTITACE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	2	321	3.1e-68	0.7692307692307693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.52e-49	1	264	135	404	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.42e-18	40	258	48	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	3.75e-15	47	259	157	346	polygalacturonase ADPG
PLN03003	PLN03003	1.51e-14	46	258	113	291	Probable polygalacturonase At3g15720
PLN02188	PLN02188	1.92e-14	46	237	122	287	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW98240.1	4.05e-109	1	391	57	428
AGC67830.1	4.05e-109	1	391	57	428
AGI38870.1	4.05e-109	1	391	57	428
ANX00772.1	5.73e-109	1	391	57	428
AVV39224.1	2.93e-94	1	393	54	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.13e-27	17	248	95	341	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	5.06e-24	17	253	114	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	1.11e-08	1	258	63	304	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	5.08e-25	2	268	119	371	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.19e-12	77	313	9	230	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	7.59e-09	46	258	113	291	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
P35339	1.61e-08	46	270	128	328	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG2C PE=2 SV=1
P18192	4.94e-08	1	258	89	330	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004224_00466.