CAZyme Information: MGYG000004230_01295

Basic Information

• Species: Clostridium sp900759995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900759995
• CAZyme ID: MGYG000004230_01295
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000004230_27|CGC1	44079.1	7.0294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004230	3516057	MAG	United Kingdom	Europe

• Gene Location: Start: 10810; End: 11982 Strand: -

Full Sequence      

MSREKELLKKVMKILVLSFSGGTILFLIIVSLIGTILYTVNKNQNGSEFKTATITDIGAL
GVPSEYINHYNEVSTKFKIPNWVLAAVTKQESNFDPNASYAGAFGLMQIQKIDILGKDLW
NSHINSGLGEEYKSFGYKFSTSDEMWNIYLKDPKAQIIAGGYIIRYYCNYVLYKFNKVSE
LNYLSNDNMDLIKWTATSGNSEFKDFEIMLKRIFACYNGGPAYGMQVDLDKAEHNYPNEV
FQYAMEFRNVGLNEGSNSIIEKAIQEGMKYVGKSPYVWGGGRTEQDVQAGRFDCSSFVHY
CYSTTGVQLGDRASVVTFFLVTKGRPINPKEMKRGDIIFFDTYTTDGHVAIYLGNNQFLH
DAEPNGVSIGSLDNSYWRISFNGKVRRVVE

Enzyme Prediction     

No EC number prediction in MGYG000004230_01295.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	1.94e-26	275	377	3	96	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.82e-20	257	378	72	190	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	3.99e-16	253	377	359	471	invasion associated endopeptidase.
PRK10838	spr	1.48e-15	280	390	85	186	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.
NF033742	NlpC_p60_RipB	1.56e-13	260	370	77	187	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWS25316.1	2.30e-144	1	390	1	395
AMN32101.1	2.30e-144	1	390	1	395
QUD74418.1	3.06e-144	4	390	2	383
QDB01094.1	8.18e-144	26	390	7	371
QAX89037.1	8.18e-144	26	390	7	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K1G_A	9.25e-13	280	389	24	124	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
4FDY_A	6.23e-09	234	389	163	311	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
3PBI_A	1.54e-08	275	366	99	192	ChainA, Invasion Protein [Mycobacterium tuberculosis]
7CFL_A	6.98e-08	255	377	13	127	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65NQ9	1.25e-42	256	390	320	452	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=cwlO PE=3 SV=1
P40767	1.24e-38	260	390	343	473	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlO PE=1 SV=2
P45296	4.65e-13	280	389	86	183	Probable endopeptidase NlpC homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nlpC PE=3 SV=1
P0AFV7	1.53e-11	280	389	85	185	Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase OS=Shigella flexneri OX=623 GN=mepS PE=3 SV=1
P0AFV4	1.53e-11	280	389	85	185	Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=mepS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999341	0.000237	0.000006	0.000002	0.000001	0.000457

TMHMM  Annotations     

start	end
13	35