CAZyme Information: MGYG000004230_01456

Basic Information

• Species: Clostridium sp900759995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900759995
• CAZyme ID: MGYG000004230_01456
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923		102541.98	5.4514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004230	3516057	MAG	United Kingdom	Europe

• Gene Location: Start: 3125; End: 5896 Strand: +

Full Sequence      

MKKKSFKKILSAVCAMATMTICFSKVQAAPIENTNSIDQSKSYIIYSGDIKTTLYDDGGN
NEGWLRQGHYLDFDNSYSWKIEKNGNNFYLKNEGTNWYVKGVAKTSNNNSNEYVVSDKSG
GSQKGEYLLEKAEGGYKLKSVSNGKYIKYGQDRDYVTFTGSASAASVWKIEEKPAYDASK
EYIIYSTNKTNALYDSGGKDVGWLQKGTYAEFNGVYSWKIEKNETGLYLKNVGTSWYVKG
NPLNLNNKDYVVSDKNGGNEKGSYKFEKVIGGYKIKSLTNNKYIRFGQDRNYITFTNNVS
EGALWKLEIAPKFEKPEGSITLWKNPNGNEFYRIPAIATANDGRLLAINDLRYDYASDLG
NHRIDLLIKSSDDNGVNWTEHKNLTVNNSRANYGFGDAAMVADRNSDKVIILAAAGDKGF
WHANSAYVSTRQNPIKVVKLVSEDGGKTFSQPEDITKKIYDLDQSWTRLFAASGRIMQSR
YVKVGDYYRIYTAILVGKGSANGGNYVLYSDDFGDTWNVLGGAITPITNADEAKIEELPN
GNVVLASRTNGGRNINIFTYDKNDSTFTKGQWESSFKKLTLGDGSACNGETYIVYAKDTA
TNEYKYLALQSLPTLNKTRKGVGIYYKELTDNDVNVDGFINGWSEDNFYMVQPRDSGYST
MSIQKDGKIAFFYEDRKENDGYDGEFITLDLKTVTNGKYEMAFAGIGSEKNPYVVETEEQ
AKAVNEVFKNEKVNWTYKVSPEVPGEVTAAATTANSAVITWNKANDNGVTVGYNIYNEKG
ERLNSDIITEERFELENLEPGKEYSITVKAVNKEGSESEAANFIFSTKSESELVNPIEDG
KKEVEPVEDEKQLAGENSGNQVQPGETVKVDDKETNAKDKNLSLSLKGLANTGDITNVSM
LIGGALLSAGGLAGLLARKRNRR

Enzyme Prediction     

No EC number prediction in MGYG000004230_01456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	325	683	6e-48	0.9385964912280702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.90e-59	324	690	6	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd00063	FN3	6.89e-11	741	824	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	2.56e-08	741	816	1	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam00041	fn3	3.17e-07	744	815	3	80	Fibronectin type III domain.
TIGR01167	LPXTG_anchor	2.38e-04	889	923	2	34	LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG19756.1	1.15e-172	315	775	115	576
AVO06163.1	1.15e-172	315	775	115	576
AWI02704.1	1.15e-172	315	775	115	576
AVO03208.1	1.15e-172	315	775	115	576
AAS10966.1	1.93e-103	294	735	105	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	3.37e-20	297	674	149	504	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MYV_A	1.02e-18	327	674	176	504	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	1.14e-18	327	674	197	525	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4Q6K_A	6.50e-16	327	674	179	507	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
6MNJ_A	1.84e-13	332	674	200	521	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15698	1.00e-17	315	674	35	380	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P31206	1.24e-15	332	674	203	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	8.51e-10	328	676	391	811	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000514	0.817621	0.180996	0.000317	0.000290	0.000233

TMHMM  Annotations     

start	end
895	917