CAZyme Information: MGYG000004231_01793

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882
• CAZyme ID: MGYG000004231_01793
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000004231_37|CGC1	44104.22	5.4872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004231	2685220	MAG	United Kingdom	Europe

• Gene Location: Start: 4786; End: 5967 Strand: +

Full Sequence      

MAEKLKLGLVGLGQRGGGLLKGLFIPSDRVEVAAVCDIYPDRTEKAVKDCTDAGKKAPFA
TCDYKELINRDKVDLVVIATPWKQHVPMVLYALEQGVACGSEVGGAESLDECFSLVETWE
KTRTPYMFLENCCYGRREMMALNMVKKGVFGEIVHCSGGYHHDLREEIGFGRENRHYRLD
EYLTRNCENYPTHELGPIAKILDINHGNRFVSLTATASKAVGMHEFIAEKKPEDTALKNA
VFAQGDIVSTIIKCERGETVALTLDTTLSRFYTRGFCVHGTKGLYEEATDSIYLDGMGEF
WNWKPNWGNAEKFAAEYEHDVWKKYRAEGIQGGHDGMDYLVYNEFFDCVREGRAMPIDAY
DAAAWMSITPLSEKSIASGSMPVEIPDFCKNRK

Enzyme Prediction     

No EC number prediction in MGYG000004231_01793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	390	9.7e-144	0.974937343358396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.56e-18	28	387	28	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.22e-07	26	122	22	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29040.1	2.10e-162	1	392	1	394
QTH41319.1	2.25e-162	1	388	4	392
QUO31207.1	1.01e-161	3	388	2	390
QNK55026.1	1.10e-158	1	392	1	393
QTH43530.1	2.29e-158	1	392	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.79e-97	3	392	19	430	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.26e-70	4	390	42	435	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	1.77e-96	3	388	32	436	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	2.62e-96	3	392	19	430	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	2.76e-89	4	392	49	456	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	7.20e-87	5	392	53	458	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	1.73e-86	6	392	44	431	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004231_01793.