CAZyme Information: MGYG000004233_00732

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter
• CAZyme ID: MGYG000004233_00732
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000004233_12|CGC1	96456.58	4.9105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004233	2952530	MAG	United Kingdom	Europe

• Gene Location: Start: 23608; End: 26085 Strand: +

Full Sequence      

MKTLEIMKNWTMHPVGTDKHYKTEIPAMAMQILYENHEIPDPYVGENEWIVYEALKNDFE
FSNVFEVSEDMLSADELVLRCEGLDTAAEIYVNETKVAFVNDMHRTYVFDVKDTVHAGEN
QIRIYFRSGIAYALEQHAKEPYYHTSDTVDGFSLVRKAHSTYGWDWGPKLPDVGIWRPIR
LQAYDTARFQDIYIRQFHEDGHVQLKIETEIARLKPEDVTLEIVLTEPQGNCVKKIYDSI
GEKVSAEITVENPQLWWCNGFGSQPLYEITCILKKEEEVLEESVKRIGLRTLTVRREKDQ
WGESFEFCVNGVSVFAMGANYIPEDCFYTRCSRERSEALIRQCVRANYNSIRVWGGGYFC
DDYFYDLCDEYGLIVWQDLLFACGVYRLHEDFVENVVQETIDNVKRLRHHASIALWCGNN
ELEWGWSGWDMGFGNRVQDKADYIKLFEWILPQTVKKMDPDRFYWLASPSSGGSFDDPND
QNRGDVHYWEVWHRLKHFTEYRKYYFRFCSEFGFQSFPSEKTINTFAAESDKNIFSPVME
NHQKNGGANGLILYYLSANFKYPSDFGTLLYVSQILQAEAIRYGVEHWRSNRGRCMGALY
WQVNDCWPVASWSSLDYYNRWKPLHYYAKKFYAPVLLSALEEKGQIRFVVSNETMQEVNA
EIIWRLRDHQGNIVEEQRKHSLVPALTAVECGEADYASISSDRWKSRKFYVEYTLCIGGQ
EISQGTVLFTRPKHFEFQDPQIHWSVEETEKEFLLTAETANYAKYIFLDSEDFDFVADDN
CFDLSKGTKKTIRIAKEDITKDGNPYVPSVKEMENLKVLSAYNIQ

Enzyme Prediction     

No EC number prediction in MGYG000004233_00732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	36	720	1.5e-103	0.6702127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.12e-95	38	775	46	768	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	4.98e-13	644	734	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	1.28e-12	78	462	129	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	1.05e-11	739	823	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.49e-06	187	290	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31658.1	0.0	1	825	1	826
QUH28340.1	5.99e-316	1	824	1	818
AUG59052.1	3.97e-307	10	817	9	806
QLG40119.1	1.82e-295	1	824	1	821
QNF27003.1	2.49e-295	1	802	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.39e-163	3	801	5	823	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.48e-163	3	801	7	825	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.52e-163	3	801	7	825	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.01e-163	3	801	5	823	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.68e-161	3	801	5	823	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	2.11e-106	24	642	31	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	3.17e-105	25	642	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	3.17e-105	25	642	32	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q5B7W2	1.15e-104	25	642	32	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
B0YBU9	1.20e-104	25	642	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004233_00732.