CAZyme Information: MGYG000004234_00482

Basic Information

• Species: Massiliomicrobiota sp002160815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160815
• CAZyme ID: MGYG000004234_00482
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000004234_15|CGC2	28284.3	5.0022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004234	2339347	MAG	United Kingdom	Europe

• Gene Location: Start: 14405; End: 15139 Strand: -

Full Sequence      

MAKIQCNVISYTLMRTVDIDVILPTVTIPESMINKGKIHHDYHKKFPVLYLLHGYGNNHA
QWCGYTNVELYAEERQIAVVMISGENKKYIDQDEDLFADFIENELPEFITQVFPVSTRKE
DTYIAGLSMGGFGALYHGLSHPERYSAIGAFSPGIEMQGNPIDLYEVLNQCQQEIPIYMA
CGDKDFLYDTNVQFVKSLKEKKMPLTWLSVPGYEHEWRFWDKCIEEFLDWIQRSDAYANA
KRKI

Enzyme Prediction     

No EC number prediction in MGYG000004234_00482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	231	5.8e-46	0.8854625550660793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	4.56e-27	43	233	51	310	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.54e-18	43	220	21	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	5.04e-15	45	228	97	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	4.78e-11	43	229	44	271	S-formylglutathione hydrolase
COG0596	MhpC	2.70e-06	47	155	22	123	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMV27398.1	4.38e-21	44	236	11	219
VTR92900.1	6.32e-21	44	236	83	291
VTR92875.1	2.15e-20	44	234	83	289
QJW99257.1	4.55e-19	44	234	84	290
QNU68529.1	4.88e-19	44	227	72	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	5.61e-38	1	231	2	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	2.01e-24	1	231	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	4.87e-24	44	231	39	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
2UZ0_A	7.92e-24	47	228	42	249	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
4ROT_A	1.23e-22	44	231	44	257	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.58e-31	1	233	1	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
A7ZX03	1.13e-10	44	228	41	267	S-formylglutathione hydrolase FrmB OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=frmB PE=3 SV=1
A7ZIA3	1.54e-10	44	228	41	267	S-formylglutathione hydrolase FrmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=frmB PE=3 SV=1
Q3Z551	1.54e-10	44	228	41	267	S-formylglutathione hydrolase FrmB OS=Shigella sonnei (strain Ss046) OX=300269 GN=frmB PE=3 SV=1
B1LIP0	1.54e-10	44	228	41	267	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004234_00482.