CAZyme Information: MGYG000004234_01113

Basic Information

• Species: Massiliomicrobiota sp002160815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160815
• CAZyme ID: MGYG000004234_01113
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000004234_48|CGC1	82347.97	6.225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004234	2339347	MAG	United Kingdom	Europe

• Gene Location: Start: 3478; End: 5685 Strand: -

Full Sequence      

MVENIIKQMTLKEKVGQLNQHLYGWQCYQKVGDHYELTDLFKKHVKEYGGVGAIYGIMRA
DAWSQIDEHNGITRQESYQVIQMIQDYIKKHSRFQIPALITEECVHGHMALQSPVYPTQL
AMGMTWNPLLMEKIAQNVSQELAAKGGNLALFTGFDVLRDPRWGRSEECFSEDAYLTSQM
IQSAVQGFEKDQNGVSVVVKHLCAQGACEGGHNSDAAKIGPRELRDIHLPPVKAAVKAGA
RAVMAAYNEIDGIPCHIHKNLLHHILRKEYGFDGIVMADGCALDRLLLLNDNPLQMGSLA
LKAGVDLSLWDQVYTKLDEAVKQGYVTEEELDIAVERILRLKEKLGLFEPSQNIPLPQCD
ELLLQSARECQVLLKNDTHILPLKKTQKIAVIGPNAHHYLHQLGDYTAYQNPQDIVTVYQ
GICKKASQVSYALGCTTRKKQFENLDETLKIAKEADVVVLVLGGNSTRLYQNAFENNGAL
RIQDENEMNCGENIDLASLELEGYQNQLLKEIHRVNPNIVTVLIQGRVHVINDVMRYSQA
VVASFYPGSRGGDGIADVLFGDYNPSGHLSVSIPRHVGALPCYYNHKHNGAQKDYIDLLS
GPLLPFGYGLSYTTFEYQNISLPQKISIQELKEKGLTITLDVHNTGQRDGEDVVQIYIKH
LQSSIVSRVLELKGFHKVYVPHHAVQTVSITLSYDDLAIWNIDMEHIVETGRLAVCVGQD
SQNYKEYSVCIEESC

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	309	1.8e-57	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.92e-151	2	728	38	761	beta-glucosidase BglX.
COG1472	BglX	1.51e-74	9	426	1	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.78e-57	156	692	159	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.37e-56	10	341	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.12e-56	372	612	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY27887.1	0.0	1	729	1	729
QMW73449.1	0.0	1	729	1	729
QPS13293.1	0.0	1	729	1	729
QQV05109.1	0.0	1	729	1	729
QNF27516.1	3.01e-241	2	733	15	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.23e-105	75	726	102	779	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.24e-102	2	725	18	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	9.27e-102	2	725	18	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	3.43e-100	2	721	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.83e-99	2	721	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.25e-111	2	728	38	761	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	4.50e-110	2	726	38	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	5.15e-101	80	722	50	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.74e-94	84	728	109	751	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.51e-73	79	718	109	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004234_01113.