CAZyme Information: MGYG000004234_02287

Basic Information

• Species: Massiliomicrobiota sp002160815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160815
• CAZyme ID: MGYG000004234_02287
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		27878.59	6.2286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004234	2339347	MAG	United Kingdom	Europe

• Gene Location: Start: 2150; End: 2860 Strand: -

Full Sequence      

MVASFCYYALTPKPEDNLKLIQDENYYQWFCMDVLSRGYYPAYMKRFFFEHNIDISITPS
DKELLLQNTSDFIAFSYYSSSVVAFEEAHQTAGNLVATIKNPYLKATKWGWQIDPIGIRV
SLNRFYNRYQKPIIIAENGLGNQDTLEMDKTIHDTYRIKYLQEHFHQIQEAQKDGVDIIA
YCLWGIIDIVSAGSCEMEKRYGVIYVDADNKGRGSYCRYKKDSFYWYQQFIEKYHQ

Enzyme Prediction     

No EC number prediction in MGYG000004234_02287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	233	2.1e-58	0.4755244755244755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	3.00e-82	1	232	236	467	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	4.95e-82	1	231	238	470	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	2.59e-78	8	232	229	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	5.10e-76	1	231	237	469	6-phospho-beta-glucosidase; Reviewed
pfam00232	Glyco_hydro_1	8.15e-59	8	233	226	450	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN12825.1	2.35e-128	1	232	241	472
BBK63001.1	3.99e-119	1	232	245	476
BBK23259.1	2.28e-118	1	232	245	476
ASZ08051.1	4.06e-113	1	231	238	468
QOG28866.1	5.09e-113	1	233	240	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.18e-83	1	232	231	463	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	7.69e-69	1	232	243	479	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	3.42e-57	8	231	251	473	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.50e-54	1	231	240	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.15e-54	1	231	240	473	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	6.72e-79	1	231	231	462	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P11988	6.65e-73	8	232	232	456	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	2.58e-71	8	231	233	456	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46130	6.25e-71	1	231	230	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	8.66e-69	8	231	232	455	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999856	0.000193	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004234_02287.