CAZyme Information: MGYG000004236_00031

Basic Information

• Species: UMGS1071 sp900542375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1071; UMGS1071 sp900542375
• CAZyme ID: MGYG000004236_00031
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000004236_1|CGC1	38639.46	4.9903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004236	2130526	MAG	United Kingdom	Europe

• Gene Location: Start: 24299; End: 25360 Strand: -

Full Sequence      

MEQTSTKIRKHATKWVVGSCGCGCSLPLVGILLLIMVCCSIMTIFASDESQGQGAIQEQY
SNYVMQYSMEFDVPPALVYAVIKAESGFNPNAVSSVGARGLMQMLPSTFESMKNNFFPED
TYTSNDLFTPEVSIKYGTKYLSETLKKYDVKETAIASYNAGQGAVDSWLKNSTYSDDGKT
LKYIPYSETRAYVETVMKYYNEYLQQVSTNPEAPVYPDISQPSEFGFIWPCPGTTVITSY
WGDGRNHKGLDVSGADCYGKPIVAVQDGTVTWANHSGWGGGYGLGAYISHGDGISTRYAH
MSQCLVNVGDTVKQGQVIGYIGNTGDSYGAHLHFEVRINDVAVDALKYLPSPQ

Enzyme Prediction     

No EC number prediction in MGYG000004236_00031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	69	206	2.9e-33	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.58e-63	60	201	4	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.20e-48	60	203	6	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.96e-42	75	201	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.59e-34	30	203	99	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01551	Peptidase_M23	6.15e-34	245	344	1	95	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41497.1	1.26e-43	59	203	42	184
QAT49510.1	4.68e-43	32	203	13	182
QNO16977.1	8.01e-43	26	215	26	216
CAB1246558.1	5.99e-42	3	203	7	197
CDZ23581.1	1.14e-41	53	196	34	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J1L_A	8.24e-20	245	348	63	163	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_C Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_A Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_C Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]
1QSA_A	2.68e-17	60	199	453	594	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	3.59e-17	60	199	453	594	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	3.71e-16	78	208	467	597	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.83e-16	78	208	496	626	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	1.39e-32	50	349	1412	1678	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.39e-32	50	349	1412	1678	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	6.24e-17	60	199	480	621	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	1.51e-16	60	199	480	621	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.51e-16	60	199	480	621	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.938859	0.044572	0.009951	0.000161	0.000112	0.006338

TMHMM  Annotations     

start	end
13	35