CAZyme Information: MGYG000004236_01098

Basic Information

• Species: UMGS1071 sp900542375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1071; UMGS1071 sp900542375
• CAZyme ID: MGYG000004236_01098
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	MGYG000004236_4|CGC1	66970.76	4.5129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004236	2130526	MAG	United Kingdom	Europe

• Gene Location: Start: 257251; End: 259032 Strand: -

Full Sequence      

MDYEYNGGINQQWQLVPTTIEQIIPDGYYEIRSAVSGKNLEVYGVSMLSGAKITQWYATG
GKNQKWKVENQDDGNVRITNVNSGLVLEYNGNTNAYEQRNWNGGSNQKWEISKTSTEGNY
CIRNQSNGYAMDVLYGAMEDGDHVVSYEYNGGVNQQWQFIQTDPDTTQVVPDGYYEIKSA
VSGKNLEVYGASTQGGAKITQWDATGGNNQKWKLENQSDGTIRLTNVNSGLVLDYNASTN
SYEQWDWHGGSNQRWQISKSQAGNYYIRNMSNNHAMDVLYGSMNNGQYVVDYEYNGGINQ
QWQLVPVELKTLQGIDVSEHQGNINWQQVKASGQVDFAIIRAGYGRETYQKDKFFEQNYA
GAKAQNIPIGIYQYSYADSVADAEREAETCLTWLNGRAVDSYVIFDFEESKIIDKLNKDD
IPDNDITPDVLSQMAIAWCKKIEAAGYTPMIYVNPDFITNKYNYKMLKESGYDIWIANYG
RSITYDWPYPVRMWQYTSSGSVSGISTNVDMNIMYTGSEYSGKFVLPDGQKGKCNSSNVN
VRTSPTTTSGNNVLFQVHNGYQFTILQEQNGWYQVSFGADRIGWISGLYVTLI

Enzyme Prediction     

No EC number prediction in MGYG000004236_01098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	315	505	1.3e-45	0.9943502824858758
CBM13	173	317	2e-23	0.75
CBM13	6	113	8.1e-19	0.5372340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	6.98e-71	313	515	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.06e-37	313	514	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	6.39e-29	315	505	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	7.97e-28	314	515	2	193	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06523	GH25_PlyB-like	8.88e-27	315	512	3	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO42089.1	6.24e-40	309	515	1	191
QAR21437.1	6.24e-40	309	515	1	191
QEY35367.1	9.28e-38	309	515	1	192
QHQ70934.1	2.71e-37	314	515	4	189
QCT06404.1	3.33e-37	315	515	5	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRT_A	3.09e-18	312	590	20	283	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRU_A	1.19e-15	312	512	20	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WW5_A	1.70e-14	315	515	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	3.98e-14	315	515	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
5A6S_A	1.66e-12	316	512	26	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.81e-13	312	590	9	272	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	1.29e-08	312	535	1	201	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
Q8HA43	4.88e-08	368	591	203	438	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2
P25310	1.89e-07	306	512	76	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004236_01098.