CAZyme Information: MGYG000004237_00946

Basic Information

• Species: CAG-492 sp000434335
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp000434335
• CAZyme ID: MGYG000004237_00946
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899	MGYG000004237_4|CGC1	97546.28	6.1884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004237	1736722	MAG	United Kingdom	Europe

• Gene Location: Start: 41317; End: 44016 Strand: +

Full Sequence      

MEKKSNNNSVKHVGSNVKRRNTTNKNVNGKKKHPRLKKVIIIFALLIVLLVLVAVGIFCG
IFFSDKFALSKDDLLLSNANTVIYDKDGNVIAELSGDENREIISIGDMCEYLPKAFVAIE
DERFYSHNGVDLKRTLAATTTYVLKGDSSFGGSTITQQLVKNITNERDNSGKAGVERKIK
EMSRAYQVEKMISKDQILELYLNIIPLGADGGDICGVEMASTYYFNKSASELSVEECAFL
AGINNAPNTYNPFKNEGDATKQEQVNKKIKDRTKTVLTKMKDLGYITNEQYQTAYTNVEN
GLAFSKGTLPSSNVKSYFIQAAINEVVEDLVEEKGFSAEYAKSRVLGGGYKIYTTQEKDV
QDKIESVYKSDEFILNSSNAKNHSQSAMVIMDHTTGQVVACMGGLGNDVDATGINRATSS
TRQPGSSFKPIISYGCGVEKGIINAGTVYYNSATTFGKNYEPKSTSTYAGPCTVRNAIEV
SSNVVSCKIMSEIGPDNAIDFARKAGITSLVKSNENSKTNDSNLSLALGGLTHGVTTLQM
AAAYSMIANNGVYNSPIFYTKVEDSAGELVIESKQTTERVMSEQNAYVMKSLLKQPVEGD
HGTATSCKISGIDVGAKTGTTNDNKDRWLCGMTPYYTAATWYGYDDNAVVNGSGNYAAKV
WNAVMKKVHEGKTSAKFTEPSGIVHVTICRKSGCKATESCSDTYSEVFAESAVPKDCEGH
SLKVCTESGKLATEYCPSTQYVGYVPEKERNPSWKTTGYSSSVPSETCTIHTGPTDKTSP
TDGVDIDISNDVVVPNVVGKTEAEAKSALKTLKVTVKYKSDSSKENGIVLSQSLSSGEVV
SKDTKITITVNKVEKKNENDNTNKNNPDGDNNTTKPDDNVKPDPNPDPDNGDGDEEKIQ

Enzyme Prediction     

No EC number prediction in MGYG000004237_00946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	87	281	9.3e-58	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	8.95e-165	68	680	43	608	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.46e-162	99	671	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.26e-127	57	720	18	770	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	2.92e-82	57	700	14	592	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	6.54e-68	83	720	50	834	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	1.66e-137	36	780	29	779
ADU75447.1	5.11e-135	69	748	64	753
ANV77201.1	5.11e-135	69	748	64	753
ALX09447.1	5.11e-135	69	748	64	753
CBF97356.1	1.01e-134	69	748	64	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	8.59e-84	70	737	11	833	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	4.90e-65	83	683	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.36e-60	83	683	19	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
2JE5_A	2.26e-60	76	695	31	664	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3ZG8_B	3.41e-60	187	707	2	499	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	6.47e-114	29	738	2	721	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	1.00e-112	29	738	2	721	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.00e-112	29	738	2	721	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q0TNZ8	2.30e-106	78	721	69	725	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	3.55e-106	78	721	69	725	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999898	0.000102	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
39	61