CAZyme Information: MGYG000004239_00310

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004239_00310
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000004239_4|CGC2	79365.66	5.4305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004239	1498755	MAG	United Kingdom	Europe

• Gene Location: Start: 69261; End: 71426 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPDAEQPVMIRVDPGEYRERVEIHRSHVT
IEGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPKGEPYGFVFHGCSFT
APDGVAPDSVYLGRPWREWAQTVLIDCWLGRHIKREGWWDWNKPAAHNCVQYAGAILHGP
AGDTTGWVPWANELDVMAVARYAREQVLAGVDGWDPEGGDGDAVETAELSANGRTVHIET
YCEDEPALRARLKREGRSAAFTGKTPADFEAWKIATRTRLYDVLGLSLMDRVPIEIRELS
RVRVAGGIVRTHAMLQVERDVWMPFYLLEPQSPKLDARGRKCCYICPHGHQGAGAASVAG
VAGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
CKTFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEEDHLN
GSRGLKNVDEQLKIVRDAYKLLGRRDALRHEVCPGGHHLGVTHLVEDIEWLDSHVAKCDR
A

Enzyme Prediction     

No EC number prediction in MGYG000004239_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	7e-79	0.9826388888888888
CE19	453	702	8.6e-27	0.6234939759036144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.72e-63	6	331	81	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	5.79e-51	16	311	10	275	Pectinesterase.
PLN02708	PLN02708	7.84e-43	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	6.79e-42	8	314	7	282	pectinesterase
PLN02432	PLN02432	2.46e-40	1	314	7	272	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	718	1	718
ATP54718.1	0.0	1	721	1	721
QUC03567.1	0.0	8	717	7	711
QRP39805.1	1.40e-99	8	336	18	349
ASN95501.1	1.40e-99	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	9.42e-29	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	9.13e-26	33	283	55	305	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	3.63e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.64e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.74e-23	16	310	17	281	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	3.47e-33	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8L7Q7	5.01e-31	18	324	301	593	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LVQ0	2.14e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O81320	2.67e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
O04887	1.32e-29	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004239_00310.