CAZyme Information: MGYG000004241_00623

Basic Information

• Species: Alistipes sp900761235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900761235
• CAZyme ID: MGYG000004241_00623
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000004241_3|CGC2	42855.25	5.8572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004241	2156541	MAG	United Kingdom	Europe

• Gene Location: Start: 95312; End: 96448 Strand: -

Full Sequence      

MKYYLIAGEPSGDLHGSNLMRGIAAEDTSAEFRFWGGDRMAEVGGKANLDKHYKETSFFG
IAQVLRNLKTIFGQISECKRDIEVFAPDVIILIDYPSFNMRIAEWAHGRGIRVFYYIAPK
VWAWKEFRVKGIRKYVDRLYIIFPFEQNYFESKGIVPVFKGNPLVDAIEQRRGSLPSRER
FVAENNLDDRPIVALLAGSRKNEIYENLPDMVALSKRFPDYRFVVTGVSWLDKSVYDRII
DGSDVAYVCDKTYETLNVAEAAVVTSGTATLETALMNIPEMVLYHVPKLYEILRPCLLKI
PFISLVNINLGYEAVREIVSSRFDIDVAAAELESILEGGSRRERMLADFARLRTIIGGAG
ASERFAKDIVEQLKNDGE

Enzyme Prediction     

No EC number prediction in MGYG000004241_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	5e-96	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.90e-95	1	375	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.84e-90	1	374	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.74e-63	4	343	2	346	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.41e-55	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.23e-35	88	308	78	285	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77950.1	1.19e-173	1	373	1	373
BBL06737.1	2.62e-170	1	376	1	376
BBL11605.1	4.30e-169	1	374	1	374
BBL08813.1	4.30e-169	1	374	1	374
BBL00808.1	6.10e-169	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.08e-30	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.54e-29	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	6.31e-64	5	373	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	6.31e-64	5	373	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	2.63e-58	5	373	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.20e-58	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	2.36e-55	5	374	11	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004241_00623.