CAZyme Information: MGYG000004243_00652

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1810; UMGS1810
• CAZyme ID: MGYG000004243_00652
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000004243_71|CGC1	63101.12	5.9754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004243	1710627	MAG	United Kingdom	Europe

• Gene Location: Start: 4097; End: 5797 Strand: +

Full Sequence      

MQNKEKFIDGIISNMTLEQKIGQCLVIGFVGTVVTPEILKRIRKYTPAGIRTGLTFRIKS
AIYDPYAYNEEFLDRVIRQPKGTVKDFCLDIPVPHCTNEEYCQFLNTLKSCAAESGAKIP
LHITLDMEGDSSADYFRGGIRYFPSQMGIASTGDAELAHDCAWAAARQLTPLGFSWIHSP
VLDVNTNPDNPEIGARSFAEDPETATKFALSALKGYQEAGLITTGKHFPGRGASSQDAHS
GLPVINASLEEMQEHLKPFQALIDAGLPSMMTAHTVYPALDDSGLPATLSKKILTDLLKN
KMGFKGAITTDDITMGGIVEKFEVYKACIMAINAGADLILIRDESNLLDEVFEKLVEAAK
TGEIPEERLNDAVRRTLSVKYDYNLFENNAIRPVKDASSGINDPKVHQIVQRAAEKTVKK
LRDRKNILPLKKSDKVLLIEQVHPLHKFTNDQNCHPSLLWEKMFKFSDNVSQVETTMDFD
ENSRKRVMARIDDADVIVITNYYFRRYANGNEFVKSLIATGKPVVVITNSPYKFSLVDEY
DTVVMNYGASVESFDEVAKLLFGERQ

Enzyme Prediction     

No EC number prediction in MGYG000004243_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	340	2.6e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.38e-83	15	439	1	359	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.39e-80	16	379	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.13e-44	156	341	97	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.25e-30	2	439	32	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI69327.1	3.27e-236	1	564	1	564
QHI69155.1	1.42e-235	6	564	7	565
AQQ71050.1	1.64e-224	2	565	13	575
AQQ69802.1	4.13e-131	6	564	7	568
QUI24198.1	8.36e-124	4	563	6	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.19e-49	15	422	11	377	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.13e-48	114	439	111	458	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.42e-48	114	439	85	432	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.12e-47	114	439	115	462	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	8.25e-47	17	564	9	516	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.17e-47	114	439	111	458	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	4.84e-39	106	380	85	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	7.64e-31	114	430	78	398	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
Q5QUZ5	3.49e-26	113	341	49	276	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
C4LEY6	1.28e-25	117	340	53	275	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004243_00652.