CAZyme Information: MGYG000004244_00403

Basic Information

• Species: UMGS1601 sp900553335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1601; UMGS1601 sp900553335
• CAZyme ID: MGYG000004244_00403
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1355	MGYG000004244_2|CGC4	146827.01	4.5923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004244	1985528	MAG	United Kingdom	Europe

• Gene Location: Start: 134695; End: 138762 Strand: +

Full Sequence      

MKLGKRLLSGVLSFAVAVSACLTSGVFAASAAEPEGNYNEKSILQVSGDALVSTSSSHYD
ENGSYNGYIQTDYADKNAETIESNYLKLTYKVKGTVTDSTQVFDFQPFNTSWGGWDDNIV
TIGDSDYDASTGIYTAYIPTQKVIQSLSSGTLNGINIMFMSDSLEVTLVDYRILSVKELS
NEDEYQLEQQKFILNITGEDLVAAGYSEADLQKLIDSNSGNVVFYVHMSKANKYSWLQSR
SGSVNNFNGNPSDFIESAAGATGASNKYLTAHDCTKQSGSNYPIQINKAGDPIGSVGTGN
YAFPSNAITSSKIKNAANYSLSVAIKTKDTEAEVLGIVFSDGTSFAVNADGTLKKGFTAP
KCESKTYENPNADPDVDGEVWEQSVTKRKANLKLSLDYIAKMDSSKYTADSWKALQNALT
TAKVEYDKSSATADSLKKARDTLENVKAKLIFADEGDGGANAMPFRELNASETIKEMGIG
TNLGNTMDGHSSFTPSETSWQSAITTKEYITALHDAGYNTLRIPVTWGNMIDDENGYAIN
ENWMNRVQEIVDYCIEQDMYAIINIHHDGAEQSGWLRVGADDIDAVMEKFECVWRNIAER
FKDYDEHLIFESMNEITCGKTESTKNASQAVNYDTPIIVNFNQLFVNTVRSTGSNNTKRW
LAAVSHYANNGSSSAFKLPEDSYNTSNRIMFALHIYSDVNGVLDRLKTTYNKFGNKDIPI
YLGEYGRTLSKDTSSESGYNDPFRANYSEITNRACQVYGICPVVWDQGFGTKGEYETGLY
SYWNRTELRPIFKTITDGMARGTFLTPSSKNLKGDFSDITYNTSYGVKVTEMTDITPSAE
SVNMTVGDIETLTATALPSNTNDVIVWTTDNDDVVTVFGGKIRARGIGKTTVHAKSLSGS
VDKEITVTVGAKDTGSKAVITTDLEEYVVVKDLGTNIIASTDNGEKLTFRTTNPEIATVN
SQGRIYGSGIGEAYVVITSESGVTKTVKAVVKDALATSDITLGLKVLYNDNTHQYWSAET
GDIITVSEDGTYTLKFDADKNLSKAAKDAGITDISNLTAIYIQDQTVALGNAKVSPLESC
NITYLSVKADGKELTLNSLAGPKSALKDSGIFDTNDPINSWEGSAVDEITVSDHVANFKS
GKPKTFEVTFELSDMKFKTAAATRKSEAIQIKASSDTEINTCPGINGTEVELSVRLAPRA
TDSVTSFISSDESVVITDLTPFVPEADASGYITAKVYVVGEGTATVTAMTENGLSVDFTI
NSAHDYHAVGTEGNDTVYECSICGHKHVGLILRGDVNGDGKVTTVDVGLANSHAKNVKSL
TGDRFLRGDVNGDGKITTLDVGMINSHAKGVKKLW

Enzyme Prediction     

No EC number prediction in MGYG000004244_00403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	496	768	3.1e-73	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.41e-49	496	766	15	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.18e-17	474	735	48	331	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	1.91e-12	1293	1347	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	4.33e-06	1294	1345	1	52	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14254	Dockerin_II	2.84e-05	1294	1347	1	52	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18792.1	4.72e-276	5	1260	4	1044
AUO19859.1	1.33e-153	392	994	37	645
BCN29385.1	8.28e-64	465	1155	349	950
AIQ47948.1	3.41e-60	465	799	36	400
AIQ53446.1	1.34e-58	465	799	36	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JEP_A	5.47e-56	469	799	34	394	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6WQP_A	9.55e-51	466	774	12	331	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	1.03e-50	469	802	13	352	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6PZ7_A	9.05e-50	467	797	6	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4IM4_A	2.33e-49	466	802	3	334	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	2.18e-56	460	799	30	399	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	3.67e-49	469	802	38	377	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	1.40e-46	466	799	23	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28621	4.58e-46	458	806	24	377	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	9.84e-46	466	807	53	389	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000449	0.390134	0.608772	0.000325	0.000169	0.000126

TMHMM  Annotations     

start	end
7	29