CAZyme Information: MGYG000004246_01157

Basic Information

• Species: HGM12669 sp900761935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12669; HGM12669 sp900761935
• CAZyme ID: MGYG000004246_01157
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000004246_7|CGC2	68824.61	5.9133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004246	2299181	MAG	United Kingdom	Europe

• Gene Location: Start: 86202; End: 88013 Strand: -

Full Sequence      

MIELIPQPKEYCEDAGQSVCLAGRHIAVSLQCDVRIVAAAQELSKDLSRLSGKFVAVYQR
PAKPGEIEITLSGGKEDDEAYELIAKQEIVRLSGKGMRGVYYAIVTLRQILDQQNGVTLP
AFTLSDKPDFPNRVFYQDISRGRVPHVKTLKRLCDTLSMLKINSLQLYLEDAFPFLELDG
EMHAGETLSAAQIMELDQYCWMHFVELVPSVSCFGHLYRLLQSKKYQYLCELEGYQPKNM
YWIEKMAHHTINPSHPNARLTVFSMIDQTIGLCRSKKFNICCDETFDLGRGKNTGRDVGA
LYFDFVSQLVQHVQSSGKEVMMWGDIVLHHPEKIANLPANITFLNWCYDPQVPVKDIDLF
TRLGCKQYVCAGTSTWNRFIGNDGCAAENICNMAKEGYRRGACGFMNTNWGDYGNICSLT
GAMLEMAVGAEAGWNAETTHMDDAFDRSFSRQLFGVRNDNMADLMREISMLEEHVDWKHV
VEWYNASYVRKDPHTARYFEADVKMCQAHIQSCHKLYQTLENLGRGDKKINDLYVAVGEI
EMLHTFALRQNGERSSIGKFDVEMWLDAMRRAWKDDSYAFGFEQIERFVQSLWSLPVSHD
EVL

Enzyme Prediction     

No EC number prediction in MGYG000004246_01157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	126	436	1e-36	0.9703264094955489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	6.41e-75	132	435	1	301	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam02838	Glyco_hydro_20b	2.29e-15	2	126	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	1.37e-11	4	359	136	518	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd02742	GH20_hexosaminidase	1.45e-11	133	349	2	212	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	1.24e-10	131	325	1	201	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS98665.1	4.04e-98	4	469	3	470
AQM60214.1	6.82e-98	4	552	3	542
AIY82316.1	1.60e-95	4	577	3	591
QAS62105.1	3.74e-93	4	483	3	487
AYE33954.1	3.74e-93	4	483	3	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DUP_A	4.33e-08	41	346	43	389	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	4.33e-08	41	346	43	389	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL4	3.19e-08	47	326	48	331	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004246_01157.