CAZyme Information: MGYG000004246_01778

Basic Information

• Species: HGM12669 sp900761935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12669; HGM12669 sp900761935
• CAZyme ID: MGYG000004246_01778
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		47145.73	6.0157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004246	2299181	MAG	United Kingdom	Europe

• Gene Location: Start: 40531; End: 41781 Strand: +

Full Sequence      

MNQTSLPIGIIGLGNRGYGLLYEILDSMPDIDVLAVCDSYIDRANHGAARVFACRGHQPF
ITTDAHTLLANAKKMGLACVMICTAWEAHIPLCIEAMEYGIPCGCEVGGAYSVEQCWDLV
RTYERTKTPVMLLENCCYGKEEMTILNMIKHGVFGEIVHCEGGYRHDLRDEITEGEIHRH
YRRRNYLNRNGELYPTHELGPIAKYLNLNRGNRMLTLTSTSCGAHGLYTFNHAAHDANFP
TRDDRFMQGDVVTTVIKCAHEQTIVLTHDTSLPRPYSRGNLCQGTFGIWSEDKHAVMLTD
HGKESDHEWTPLEKMYEKWLHPLWRHYDAVGGHDGMDYLVLSAFFDAVRNDTPMPIDVYD
MASWMVVTALSEQSVAMGSMPVPIPDFTNGMWLCRAPYHRSRYCLEDVCEECFSTK

Enzyme Prediction     

No EC number prediction in MGYG000004246_01778.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	6	392	3e-134	0.9774436090225563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.43e-13	6	167	4	158	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	0.003	8	131	3	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	0.010	6	54	1	49	Predicted dinucleotide-utilizing enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29040.1	2.07e-141	3	398	2	401
AEE95391.1	2.44e-140	2	411	5	411
QTH41090.1	2.11e-139	1	393	1	394
AEF80535.1	8.75e-137	2	414	5	419
QUO31207.1	1.74e-136	3	395	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.10e-86	2	392	17	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.72e-73	6	397	43	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	3.00e-95	5	397	33	446	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	9.01e-95	2	397	49	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	8.38e-92	2	397	46	462	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Y8C8	6.54e-86	8	392	57	448	Glycosyl hydrolase family 109 protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=Sputcn32_2490 PE=3 SV=1
A1RI61	9.23e-86	8	392	57	448	Glycosyl hydrolase family 109 protein OS=Shewanella sp. (strain W3-18-1) OX=351745 GN=Sputw3181_1518 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004246_01778.