CAZyme Information: MGYG000004251_00160

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter
• CAZyme ID: MGYG000004251_00160
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		33089.42	10.2348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004251	1695871	MAG	United Kingdom	Europe

• Gene Location: Start: 533; End: 1420 Strand: -

Full Sequence      

MFQDFFKNLYFQNLKVKAYNLIGQKKLFIYTHPRMWMFFASLLLVCITLLCVKPEFVKGV
SESLPIKEAHASTAPGTITETPNWVKTDVLTAQQKEEHTKLDELKQKQRVASWISKRYKI
AGKASNLFVTTAYKTAFDIGLDPHLILAVMAIESRFNPYAESSMGAQGLMQVMAKIHADK
FEDHGGIQYALDPVVNIKVGSRILKEYVKQTGSVERALKTYVGAAQMSHDNGYGNKVIGE
YKMLKAVASGSKVSTLAQAKSTDKRSARQRKVINPSSLSAQERKEQRIHDNPALL

Enzyme Prediction     

No EC number prediction in MGYG000004251_00160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	143	245	1.3e-16	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01464	SLT	1.68e-18	140	221	9	92	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.42e-18	111	282	122	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.20e-17	143	218	1	75	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	4.62e-16	140	218	16	99	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.48e-15	136	218	14	101	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ45275.1	2.89e-195	1	295	1	295
QDX33894.1	2.89e-195	1	295	1	295
ARQ77567.1	2.89e-195	1	295	1	295
QOL49445.1	9.39e-67	47	256	51	262
AKU21846.1	1.72e-63	44	256	35	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	4.84e-07	141	229	20	103	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	2.90e-06	122	221	1416	1511	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.90e-06	122	221	1416	1511	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A8API2	3.05e-06	123	204	188	275	Membrane-bound lytic murein transglycosylase C OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
35	57