CAZyme Information: MGYG000004255_00151

Basic Information

• Species: Amulumruptor sp900547825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor sp900547825
• CAZyme ID: MGYG000004255_00151
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000004255_2|CGC3	38104.65	9.121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004255	2427013	MAG	China	Asia

• Gene Location: Start: 68849; End: 69874 Strand: +

Full Sequence      

MTPTPPASTLPPVAVIILNWNGRDLLRRFLPSVTANTPGALARVIVADNGSTDGSVEMLA
AEFPQVEVLAFTENHGFAEGYNLALQRTGYRYTVLLNSDVEVTPGWLEPLYRYMETNPHV
AAVQPKIMSYTDRTSFEYAGACGGYLDRHGYPYCRGRLFATVEHDEGQYDTPAQVDWASG
AALMVRTALYQEAGGLDAGFFAHMEEIDLCWRLRLMGYTLAAVPASTVYHLGGGSLPASS
PRKTYLNFRNSLLMLHKNLPEPARSRILLRRRLLDTLAFGQFVLTGRWSHAGAILKAHRH
FRTMRRNYKDMPLSTPNLLGSINIITAYYLRRRHTCATLPH

Enzyme Prediction     

No EC number prediction in MGYG000004255_00151.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	15	244	4.2e-24	0.7966101694915254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.24e-55	15	232	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.80e-52	13	260	5	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.25e-23	15	124	2	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.21e-19	15	123	1	111	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04185	GT_2_like_b	1.30e-18	15	254	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36115.1	8.30e-141	12	339	4	330
QQR09216.1	2.63e-140	11	333	7	328
ANU63451.1	2.63e-140	11	333	7	328
ASB38469.1	2.63e-140	11	333	7	328
QCP73803.1	1.80e-139	13	332	12	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	4.11e-17	15	230	7	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	4.11e-17	15	230	7	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P55465	7.10e-08	6	230	620	845	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P46370	9.99e-08	13	230	132	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
P36667	1.48e-07	13	230	2	219	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004255_00151.