CAZyme Information: MGYG000004255_00384

Basic Information

• Species: Amulumruptor sp900547825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor sp900547825
• CAZyme ID: MGYG000004255_00384
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38613.17	10.5721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004255	2427013	MAG	China	Asia

• Gene Location: Start: 3199; End: 4245 Strand: +

Full Sequence      

MNVTLARFSALGDVAMTIPALYDACLSHPSWHFTMLTKPGMKGIFLNAPSNLRVVGVELD
GQHKGAPGMWRLLSTLRQEGAIDCFVDLHNVLRTRILGIFCHLRGIPVFRIDKGRRDKRK
LIRAKDKVMRQLPSSIERYLNAITAAGITVKPRFRSLFNGRAADPAMFASVTSPKRSGER
WIGIAPFARHDGKIYPPDLMAKVIDTLAWQGGTRLFLFGAGEKERDQIEQWRAGLGNIIN
MAAVKAGFTAELALMSHLDLMLSMDSANMHLAAIAGAPTLSIWGATHPFAGFTAWRQPRE
SMLGADMECRPCSVFGDRPCRYGDYRCLRAITPDEVVRRINLAIAPKK

Enzyme Prediction     

No EC number prediction in MGYG000004255_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	69	323	1.1e-34	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.22e-42	7	341	6	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.00e-29	1	348	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.95e-13	69	325	1	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.27e-07	178	296	182	297	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	1.13e-118	2	346	4	348
QQR08225.1	9.13e-113	2	344	11	352
ANU64408.1	9.13e-113	2	344	11	352
ASB37493.1	9.13e-113	2	344	11	352
AHF12543.1	1.76e-102	2	341	5	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004255_00384.