CAZyme Information: MGYG000004257_01421

Basic Information

• Species: Parolsenella sp900543875
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900543875
• CAZyme ID: MGYG000004257_01421
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000004257_62|CGC1	38966.05	5.1028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004257	1760601	MAG	China	Asia

• Gene Location: Start: 4980; End: 6056 Strand: +

Full Sequence      

MLLHRSEHEGRAGQSARVLHGVNLAGWLVLEPWVTPSLFSGTAAFSEAELADAMAPGRFD
ALLARHRASFIDEGDFARIAQRGFDAVRLQVPWFVLGDEGPMPGPASGCVEYVDAAMDWA
EAAGVSVLLDVAVAPGADPTSPSSFFGDTRTFRQAMLDVVGSLADRYADRESFLGIEPID
EVRGRARRGLSLVEGVPPHLIRNFYRDAYDVLREAAGERPVLVLHDAYLPDAWRAFMSPA
RYVNVWLDSHIYHYDQAMGAAGPAGVRRLVKESADYLARARRSGLPVMVGEWSSALPLAS
AGMTPEGRIALERVYAAGQMGAFAGGAGWFFQTWKTDARLSSWDARVALSSFETGMFD

Enzyme Prediction     

No EC number prediction in MGYG000004257_01421.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	309	3.6e-43	0.8609271523178808

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.14e-16	11	252	10	254	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.40e-05	69	292	23	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	3.74e-207	1	358	1	360
BCV19183.1	5.34e-128	17	358	4	347
ADK68544.1	1.08e-122	17	356	4	345
SDR87855.1	2.17e-122	15	356	2	345
QOY61077.1	4.36e-117	19	356	6	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	9.66e-33	19	292	3	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	6.80e-32	19	292	3	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	2.03e-23	18	337	8	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	5.51e-23	18	337	14	368	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	7.09e-23	18	337	8	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D4Q5	1.58e-33	18	351	41	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
A1CRV0	2.99e-33	16	351	39	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
B8N151	1.80e-32	19	357	31	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	1.80e-32	19	357	31	392	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B0XN12	4.08e-32	18	351	41	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999962	0.000067	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004257_01421.