CAZyme Information: MGYG000004264_01286

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Slackia_A
• CAZyme ID: MGYG000004264_01286
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193		20958.27	4.0784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004264	1480217	MAG	China	Asia

• Gene Location: Start: 78; End: 659 Strand: -

Full Sequence      

MVVIAVAFVGFSMWAASQREAQEGYEGLPVYTTSDMVAAAQAMQHEYGHPAGCTIAQIIQ
ESGQGNGLSALAERDNNLFGMKWSSSYEGKQGVVGPVTWDTNEEYDGQTVTVAGTFIAFE
SKVACIEFRSSVFLQASRYADNPTIQRAIETADSALMAYGLQSAGWATDSSYAEHLIALM
GQYDLYRFDAQVE

Enzyme Prediction     

No EC number prediction in MGYG000004264_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	36	185	3.7e-25	0.9921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.77e-26	36	190	50	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.25e-23	37	189	168	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	6.97e-14	40	189	19	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.52e-12	37	127	1	75	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12713	flgJ	1.42e-11	21	182	173	325	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV55474.1	6.20e-57	1	189	212	401
QIA34838.1	6.20e-57	11	190	224	402
ATP54961.1	1.22e-56	11	190	224	402
BAK43713.1	2.40e-56	1	189	212	401
BAK44675.1	2.40e-56	1	189	212	401

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.38e-11	40	189	59	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.543390	0.448733	0.006879	0.000458	0.000210	0.000313

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004264_01286.