CAZyme Information: MGYG000004266_00412

Basic Information

• Species: Streptococcus sp900550895
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900550895
• CAZyme ID: MGYG000004266_00412
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		57700.22	4.7403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004266	1795280	MAG	China	Asia

• Gene Location: Start: 14424; End: 16013 Strand: +

Full Sequence      

MYLNNAYFGNGVWGVEDASKKYFGVSASQLTLDQAATLAGMLKGPELYNPLNSVETSTNR
RDTVLQNMVAAGYIDKNQETEAAGADMASQLQDKYEGKISDYRYPSYFDAVVNEAVSKCN
LTEEEIVNNGYRIYTELDQNYQANMQVVYENTSLFPKAEDGTHAESGSVALEPKTGGVRG
VVGRVAGDDKLGFRNFNYATQSKRSPGSTIKPLVVYTPAVEAGWALNKQLDNHTMQYDSY
QVDNYAGIKTSPEVPMYQALAESLNLPAVATVNTLGIDKAFDAGERFGLNMEKVDRVLGV
ALGGGVETNPLQMAQAYAAFANGGLMPEAHFITRIENASGQVIKSHKNSQKRVIDKSVAD
KMTSMMLGTFTNGTGISSSPADYVMAGKTGTTEAVFNPEYTSDQWVIGYTPDVVISHWLG
FPTTDENHYLAGSTSNGAAHVFRSMANTILPYTPGSTFTVENAYKQNGIEPENTKKRAVE
NETNQSEDPIGDIRSRAQNLVDEAGRAISEAKIKEKAQTIWDSILNLFR

Enzyme Prediction     

No EC number prediction in MGYG000004266_00412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	1	69	1.7e-23	0.384180790960452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.46e-146	1	452	98	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.08e-144	1	506	173	644	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.72e-73	2	480	164	748	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	3.70e-49	2	485	244	706	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	2.77e-34	2	525	154	641	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL97614.1	0.0	1	529	203	731
QQL00020.1	0.0	1	529	203	731
ATF55939.1	0.0	1	529	203	731
QRO07766.1	0.0	1	529	203	731
ANR74848.1	0.0	1	529	203	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	2.10e-131	1	527	15	531	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	9.53e-124	2	527	16	531	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	1.07e-43	1	449	123	588	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.79e-39	1	449	132	597	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
2JE5_A	2.32e-37	2	445	151	633	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DNB6	0.0	1	529	203	731	Penicillin-binding protein 2a OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbp2a PE=1 SV=1
A0A0H2ZMF9	0.0	1	529	203	731	Penicillin-binding protein 2a OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=pbp2a PE=1 SV=1
P38050	8.69e-64	1	469	163	636	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	2.10e-52	2	421	171	581	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
P39793	1.87e-49	1	420	191	613	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004266_00412.