CAZyme Information: MGYG000004266_00678

Basic Information

• Species: Streptococcus sp900550895
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900550895
• CAZyme ID: MGYG000004266_00678
• CAZy Family: GT1
• CAZyme Description: 4'-demethylrebeccamycin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		47814.77	5.1893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004266	1795280	MAG	China	Asia

• Gene Location: Start: 11460; End: 12728 Strand: +

Full Sequence      

MRKIKIDVVVVPLSGHLFPTLNLLAPLLKDPLYEIRLFTGPQRKTVAEEMGFRVIPILEN
CVDEFERVANNEGQLNLFSAYRQLSASLDLINVVSDQLVQEWQENRPDIVIADFITLSGG
LVAEQLNIPWITTMATQFAIETTDGPPCFFGGMGSPKTSFQSGLQWTGRKGTRLGKRIVS
FLLRERLKRYDFKLYNQKGQETIYSPYSILGIGMKELELKSGFPEHYLWVGPFGSSIERA
ENYPLDLSPYAGYKKVLVSCGTQLAWAKDNLLYQTQQLAEAHPDCHFFVTLGFGGQDFQC
EELMDNVSVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIIYGKPALILPHDYDQYDYAVRG
LEAGIALTAKREDTEAIGRAFDELLARDDWADLNKLSRAAQIYQPTEILKSEIHRLLGDK
EK

Enzyme Prediction     

No EC number prediction in MGYG000004266_00678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	20	415	1.7e-18	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	3.23e-28	5	422	3	404	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	2.79e-26	5	385	2	373	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam04101	Glyco_tran_28_C	2.03e-04	256	361	2	106	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
cd03785	GT28_MurG	0.007	15	129	11	114	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR76225.1	2.79e-314	1	422	1	422
ATF57445.1	2.79e-314	1	422	1	422
QRO08088.1	8.00e-314	1	422	1	422
QQL00321.1	8.00e-314	1	422	1	422
QLL97959.1	8.00e-314	1	422	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.77e-13	1	373	1	338	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.82e-13	1	373	1	338	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
7LVY_A	2.62e-07	302	389	339	421	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]
6J31_A	3.07e-07	6	366	7	340	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	3.09e-07	6	366	10	343	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	9.95e-13	1	373	1	338	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q8KHE4	6.10e-09	5	385	4	388	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
O75795	2.08e-06	93	368	132	415	UDP-glucuronosyltransferase 2B17 OS=Homo sapiens OX=9606 GN=UGT2B17 PE=1 SV=1
P17717	2.08e-06	56	385	111	434	UDP-glucuronosyltransferase 2B17 OS=Mus musculus OX=10090 GN=Ugt2b17 PE=1 SV=1
Q65JC2	2.96e-06	11	376	11	346	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004266_00678.