CAZyme Information: MGYG000004266_01481

Basic Information

• Species: Streptococcus sp900550895
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900550895
• CAZyme ID: MGYG000004266_01481
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		22968.23	9.2466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004266	1795280	MAG	China	Asia

• Gene Location: Start: 2757; End: 3371 Strand: -

Full Sequence      

MFKFIRRMLVLAVILFAGYKVYRVHQDVKQVMTYQPMVREILSEKDTPANEELVLAMIYT
ETKGKEGDVMQSSESASGSTNTINDNASSIRQGIQTLTDNLYLAQSKGVDVWTAVQAYNF
GPAYIDFIAQNGKKNTLALAKRYSRETVAPILGNTTGKTYSYIHPISIFHGAELYVNGGN
YYYSRQVQLNLYIIKCFTFFSTSG

Enzyme Prediction     

No EC number prediction in MGYG000004266_01481.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.72e-84	28	191	1	165	Lysozyme-like.
cd16891	CwlT-like	7.68e-67	34	191	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	4.24e-10	1	198	93	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMH88621.1	9.81e-135	1	204	1	204
ALD68078.1	1.39e-134	1	204	1	204
VFI24373.1	1.98e-134	1	204	1	204
VGM76808.1	1.98e-134	1	204	1	204
VFI25033.1	1.98e-134	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	7.85e-18	30	188	23	174	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	5.38e-16	30	188	25	175	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DPY9	1.09e-132	1	204	1	204	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q9AHT6	1.55e-132	1	204	1	204	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
P0DC90	5.75e-71	14	200	13	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	5.75e-71	14	200	13	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	8.16e-71	14	200	13	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.986470	0.004778	0.008585	0.000027	0.000014	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004266_01481.