CAZyme Information: MGYG000004266_01594

Basic Information

• Species: Streptococcus sp900550895
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900550895
• CAZyme ID: MGYG000004266_01594
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		37087.44	6.1276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004266	1795280	MAG	China	Asia

• Gene Location: Start: 1906; End: 2901 Strand: -

Full Sequence      

MPKFIEDGWEVHYIGDKHGIEHQEILKSGLNVTFHSIATGKLRRYFSWQNMLDVFKVGWG
IVQSLFIMLRLRPQALFSKGGFVSVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATK
MYSTFEQASSLSKVEHVGAVTKVSDQNTPEPDELVDIQTHFDPKLPTVLFVGGSAGARVF
NQLVTDHKQELTERYNIINLTGDSSLNELSQNLFRVDYVTDLYQPLMEMADVVVTRGGAN
TIFELLAMAKLHLIVPLGREASRGDQIENAAYFVKKGYAEELQESDLTLESLEAKLSHLL
SHKDQYQASMKASTELKSLADFYDLLRKDLA

Enzyme Prediction     

No EC number prediction in MGYG000004266_01594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	167	317	3.3e-33	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.72e-127	2	331	23	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	4.55e-102	2	331	22	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	5.58e-82	1	311	22	334	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	2.31e-76	4	320	23	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	6.99e-62	3	326	23	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR75501.1	4.36e-236	1	331	22	352
QXW60949.1	6.19e-236	1	331	22	352
AQA08608.1	8.80e-236	1	331	22	352
QQK99707.1	1.03e-234	1	331	22	352
QRO07431.1	1.03e-234	1	331	22	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.43e-20	3	304	25	326	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	6.14e-20	8	292	34	315	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	7.40e-17	6	328	35	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2IN77	5.77e-226	1	331	22	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain CGSP14) OX=516950 GN=murG PE=3 SV=1
B1IAM4	8.19e-226	1	331	22	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain Hungary19A-6) OX=487214 GN=murG PE=3 SV=1
P0CB60	2.35e-225	1	331	22	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=murG PE=3 SV=1
C1C649	6.72e-225	1	331	22	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain 70585) OX=488221 GN=murG PE=3 SV=1
Q8DQM1	1.36e-224	1	331	22	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999954	0.000034	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004266_01594.