CAZyme Information: MGYG000004267_00381

Basic Information

• Species: Porphyromonas asaccharolytica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas asaccharolytica
• CAZyme ID: MGYG000004267_00381
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000004267_7|CGC1	38040.63	6.0049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004267	2088006	MAG	China	Asia

• Gene Location: Start: 11577; End: 12572 Strand: -

Full Sequence      

MNHTRKNEIRCDPTRMRRLLRSITLSLWGAVLVGVVYYFVVVHQRSQTQTARTQIAPQTE
WHDVPIADVGAGEVYEELEQYGTLYALEYLLDYDSIWPRDELQRLILFGLYDEEDDDDEE
VLVCVTPMKSTTSKGSSEQSQVQSTRRQGAISDWNYLFQQYGERYGWDWYVLASIAYQES
HFRAEVVGMGGATGLMGIMPATGRRYGYSRAKLKHAESSIRVACMALRDFGRAFAHITDA
EQRMKFTLASYNAGNAHVLDARRLAENAGLDPDRWDDSVEIYMARLDEPKYYQDPLVQHG
RANGDHTVRYVAEVFHRAQSYKKKVQYATAE

Enzyme Prediction     

No EC number prediction in MGYG000004267_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	164	327	7.3e-21	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	7.23e-67	158	323	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.02e-30	154	314	271	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	2.35e-26	153	312	289	441	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	9.91e-14	154	275	6	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.10e-13	159	273	9	121	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	1.91e-234	1	331	1	331
BAK25352.1	2.94e-50	133	324	272	471
AUR47574.1	2.94e-50	133	324	272	471
AKV63991.1	1.57e-49	133	324	272	471
ALO29436.1	1.57e-49	133	324	272	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	3.01e-14	158	314	263	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	3.08e-14	158	314	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	3.08e-14	158	314	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	4.31e-14	158	314	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	4.31e-14	158	314	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.38e-19	157	324	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q0AQY9	4.71e-19	157	314	292	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A1U3J1	1.86e-18	157	314	289	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q8EC56	3.15e-18	168	314	291	432	Membrane-bound lytic murein transglycosylase F OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mltF PE=3 SV=2
A5F353	4.88e-18	154	320	301	460	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42