CAZyme Information: MGYG000004268_00693

Basic Information

• Species: Pauljensenia bouchesdurhonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia bouchesdurhonensis
• CAZyme ID: MGYG000004268_00693
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		30885.26	4.521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004268	1139686	MAG	China	Asia

• Gene Location: Start: 385; End: 1263 Strand: +

Full Sequence      

MSGVPEAYQDAVWRAGQACDVVSPSLIAAQADHESAHTWDPQITSPAGARGISQFMPATW
ATHGHDGDGDGRADITNGADSIYSQGLYMCELAQNIDSWLASGLVSGDRVDLTLAAYNAG
PGAVRSWGGIPPFKETQGYVKSIRQAQASFVETVTSEPSGDGTLLAQARTHLGTPYVWGG
ETSAGVDCSGLIMLSYAELGHPFPASVRTADQITKYSDAAPIARDQLVVGDMIGFSHTPG
GYVDHIGVYAGTDAAGHPIMVHAPDVGGVVEETRLDTPYWQGMTWWPIRRPV

Enzyme Prediction     

No EC number prediction in MGYG000004268_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	16	151	2.2e-26	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	8.88e-28	22	149	3	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.27e-25	24	148	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.78e-22	5	143	3	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam00877	NLPC_P60	3.90e-18	173	289	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.84e-17	142	285	54	194	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT86054.1	3.79e-90	1	289	33	312
VEG28534.1	1.36e-68	4	275	271	522
CED91304.1	1.88e-65	1	251	39	291
VEI18427.1	1.26e-62	4	273	42	293
VEG29992.1	3.24e-59	1	277	36	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	4.06e-08	5	159	450	607	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
4XCM_A	7.41e-08	161	281	114	221	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
1SLY_A	7.26e-07	5	159	450	607	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
2K1G_A	9.72e-07	164	281	9	114	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
6B8C_A	1.72e-06	164	271	31	127	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	1.72e-13	22	156	1435	1550	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.72e-13	22	156	1435	1550	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P76190	1.07e-12	171	281	151	255	Murein DD-endopeptidase MepH OS=Escherichia coli (strain K12) OX=83333 GN=mepH PE=1 SV=1
O31608	1.26e-11	22	143	73	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
A4QFQ3	1.03e-08	101	276	36	201	Probable endopeptidase cgR_2070 OS=Corynebacterium glutamicum (strain R) OX=340322 GN=cgR_2070 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004268_00693.