CAZyme Information: MGYG000004268_00745

Basic Information

• Species: Pauljensenia bouchesdurhonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia bouchesdurhonensis
• CAZyme ID: MGYG000004268_00745
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		26920.33	4.25

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004268	1139686	MAG	China	Asia

• Gene Location: Start: 84; End: 860 Strand: +

Full Sequence      

MAADRSYTRAEMPLGEGGETIHVVADGATTDVVASAAEGTTAILQKAGISAGPIDRVTLE
NSGGDITLRVARVVRGNITTTTEIPYDTEEREDAEAEQGTEKTIQEGVVGSQTTESYQET
IDGQVTVSAVLTTTRTEPTPRIISKGTKEKKAEETKNSSDSSSSSSSSSSSSSPAVASGD
DAAIWAAIAQCESGGNPSTNTGNGYYGMYQFSLPTWQSVGGTGLPSDASAEEQTMRARML
QQRAGWGQWGCAYKLGLV

Enzyme Prediction     

No EC number prediction in MGYG000004268_00745.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	2.17e-25	190	251	8	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam06737	Transglycosylas	6.64e-20	190	252	10	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
pfam07501	G5	8.04e-08	78	148	4	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	3.68e-07	24	150	156	286	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQC44018.1	2.13e-134	1	258	125	375
AKU65288.1	8.64e-134	1	258	125	375
QGS11536.1	1.45e-132	1	258	125	386
QCT35004.1	1.18e-131	1	258	125	386
SDT86977.1	8.87e-78	1	257	128	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XSF_A	3.16e-15	181	256	27	106	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4CGE_A	5.07e-15	185	249	4	68	ChainA, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_B Chain B, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_C Chain C, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_D Chain D, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_E Chain E, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_F Chain F, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis]
4KL7_A	1.12e-14	183	256	1	78	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	1.15e-14	183	256	2	79	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
3EO5_A	1.35e-14	181	256	90	169	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	6.41e-19	26	257	163	373	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
O86308	1.11e-18	185	258	47	121	Resuscitation-promoting factor Rpf OS=Micrococcus luteus OX=1270 GN=rpf PE=1 SV=2
P9WG27	9.96e-14	176	249	45	118	Resuscitation-promoting factor RpfD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfD PE=1 SV=1
P9WG26	9.96e-14	176	249	45	118	Resuscitation-promoting factor RpfD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfD PE=3 SV=1
H8F3N4	2.71e-13	175	249	27	101	Resuscitation-promoting factor RpfC OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999906	0.000133	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004268_00745.